TRPM2 antibody (N-Term)
-
- Target See all TRPM2 Antibodies
- TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRPM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRPM2 antibody was raised against the N terminal of TRPM2
- Purification
- Affinity purified
- Immunogen
- TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
- Top Product
- Discover our top product TRPM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))
- Alternative Name
- TRPM2 (TRPM2 Products)
- Synonyms
- EREG1 antibody, KNP3 antibody, LTRPC2 antibody, NUDT9H antibody, NUDT9L1 antibody, TRPC7 antibody, Trpm2-predicted antibody, TRPM2 antibody, si:ch73-263b18.1 antibody, 9830168K16Rik antibody, C79133 antibody, Trp7 antibody, Trrp7 antibody, transient receptor potential cation channel subfamily M member 2 antibody, transient receptor potential cation channel, subfamily M, member 2 antibody, transient receptor potential cation channel subfamily C member 7 antibody, TRPM2 antibody, Trpm2 antibody, trpm2 antibody, TRPC7 antibody
- Background
- The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
- Molecular Weight
- 171 kDa (MW of target protein)
-