SLC7A11 antibody
-
- Target See all SLC7A11 Antibodies
- SLC7A11 (Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11 (SLC7A11))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC7 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
- Top Product
- Discover our top product SLC7A11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A11 Blocking Peptide, catalog no. 33R-4402, is also available for use as a blocking control in assays to test for specificity of this SLC7A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A11 (Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11 (SLC7A11))
- Alternative Name
- SLC7A11 (SLC7A11 Products)
- Synonyms
- SLC7A11 antibody, DKFZp468E122 antibody, CCBR1 antibody, xCT antibody, 9930009M05Rik antibody, AI451155 antibody, sut antibody, solute carrier family 7 member 11 antibody, solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 antibody, SLC7A11 antibody, Slc7a11 antibody
- Background
- SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
- Molecular Weight
- 55 kDa (MW of target protein)
-