RNASE1 antibody

Catalog No. ABIN635679

Product Details anti-RNASE1 Antibody

Target: RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNASE1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RNASE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNASE1 Blocking Peptide, catalog no. 33R-6094, is also available for use as a blocking control in assays to test for specificity of this RNASE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNASE1

Target: RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))

Alternative Name: RNASE1 (RNASE1 Products)

Synonyms: RNASE1 antibody, RNS1 antibody, ATRNS1 antibody, RIBONUCLEASE 1 antibody, T17M13.16 antibody, T17M13_16 antibody, ribonuclease 1 antibody, RIB1 antibody, AI574248 antibody, Rib-1 antibody, Rib1 antibody, SRN antibody, ribonuclease A family member 1, pancreatic antibody, ribonuclease pancreatic-like antibody, ribonuclease A family member k6 antibody, Ribonuclease 1 antibody, ribonuclease 1 antibody, ribonuclease, RNase A family, 1 (pancreatic) antibody, ribonuclease pancreatic antibody, RNASE1 antibody, LOC475395 antibody, RNASE6 antibody, Rnase1 antibody, RNS1 antibody, LOC101113761 antibody

Background: This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases.

Molecular Weight: 15 kDa (MW of target protein)