RNASE1 antibody
-
- Target See all RNASE1 Antibodies
- RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNASE1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNASE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS
- Top Product
- Discover our top product RNASE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNASE1 Blocking Peptide, catalog no. 33R-5686, is also available for use as a blocking control in assays to test for specificity of this RNASE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNASE1 (Ribonuclease, RNase A Family, 1 (Pancreatic) (RNASE1))
- Alternative Name
- RNASE1 (RNASE1 Products)
- Synonyms
- RNASE1 antibody, RNS1 antibody, ATRNS1 antibody, RIBONUCLEASE 1 antibody, T17M13.16 antibody, T17M13_16 antibody, ribonuclease 1 antibody, RIB1 antibody, AI574248 antibody, Rib-1 antibody, Rib1 antibody, SRN antibody, ribonuclease A family member 1, pancreatic antibody, ribonuclease pancreatic-like antibody, ribonuclease A family member k6 antibody, Ribonuclease 1 antibody, ribonuclease 1 antibody, ribonuclease, RNase A family, 1 (pancreatic) antibody, ribonuclease pancreatic antibody, RNASE1 antibody, LOC475395 antibody, RNASE6 antibody, Rnase1 antibody, RNS1 antibody, LOC101113761 antibody
- Background
- This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases.
- Molecular Weight
- 15 kDa (MW of target protein)
-