SLC2A2 antibody
-
- Target See all SLC2A2 Antibodies
- SLC2A2 (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC2A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GLUT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST
- Top Product
- Discover our top product SLC2A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLUT2 Blocking Peptide, catalog no. 33R-4171, is also available for use as a blocking control in assays to test for specificity of this GLUT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC2A2 (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 2 (SLC2A2))
- Alternative Name
- GLUT2 (SLC2A2 Products)
- Synonyms
- glut2 antibody, wu:fb62h10 antibody, slc2a2 antibody, MGC83262 antibody, SLC2A2 antibody, GLUT2 antibody, GTT2 antibody, Glut2 antibody, AI266973 antibody, Glut-2 antibody, solute carrier family 2 (facilitated glucose transporter), member 2 antibody, solute carrier family 2 member 2 L homeolog antibody, solute carrier family 2 member 2 antibody, solute carrier family 2, facilitated glucose transporter member 2 antibody, slc2a2 antibody, slc2a2.L antibody, SLC2A2 antibody, LOC100534484 antibody, Slc2a2 antibody
- Background
- Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Warburg Effect
-