You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Kallikrein 7 antibody for Immunohistochemistry

Recommended Kallikrein 7 Antibody (supplied by: Log in to see )

Kallikrein 7 (KLK7) Antibodies
  • Prss6
  • SCCE
  • PRSS6
  • hK7
  • kallikrein related-peptidase 7 (chymotryptic, stratum corneum)
  • kallikrein-related peptidase 7
  • Klk7
  • KLK7
This Kallikrein 7 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4328116
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.145213 ABIN2428333 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
9.145213 ABIN2421779 IHC ELISA Rabbit IgG Log in to see Polyclonal
1 ABIN441432 IHC (p) IHC WB Rabbit IgG Center Log in to see Polyclonal 2
1 ABIN1876692 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1859557 ICC IHC IP WB Rabbit IgG AA 23-253 Log in to see Polyclonal
1 ABIN1885824 IHC WB Rabbit AA 1-237 Log in to see Polyclonal
1 ABIN1908535 IHC ELISA WB APC Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN1908536 IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN1908537 IHC ELISA WB Biotin Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN1908538 IHC ELISA WB FITC Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN1908540 IHC ELISA WB HRP Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN1908539 IHC ELISA WB PE Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN2611733 ELISA IHC WB Rabbit IgG AA 75-104 Log in to see Polyclonal
1 ABIN2406294 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2881125 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2295078 IHC ELISA WB APC Rabbit IgG AA 75-104, Center, Internal Region Log in to see Polyclonal
1 ABIN2295084 IHC ELISA WB FITC Rabbit IgG AA 75-104, Center, Internal Region Log in to see Polyclonal
1 ABIN2295087 IHC ELISA WB HRP Rabbit IgG AA 75-104, Center, Internal Region Log in to see Polyclonal
1 ABIN2295090 IHC ELISA WB PE Rabbit IgG AA 75-104, Center, Internal Region Log in to see Polyclonal
1 ABIN2895316 IHC WB Rabbit Log in to see Polyclonal

Top referenced anti-Kallikrein 7 antibody for Immunohistochemistry

Similar anti-Kallikrein 7 Antibodies

Application / Reactivity Human
Blocking Peptide (BP) 1 Antibodies
ELISA 26 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 3 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 31 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 12 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Neutralization (Neut) 2 Antibodies
Western Blotting (WB) 66 Antibodies


Antigen Kallikrein 7 (KLK7) Antibodies
Reactivity Human
(83), (33), (28), (2), (2), (2), (2), (1)
Host Rabbit
(88), (8)
Conjugate This Kallikrein 7 antibody is un-conjugated
(6), (6), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(76), (37), (35), (13), (11), (6), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Kallikrein 7 Antibody

Target Details Kallikrein 7 Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM

Target Details Kallikrein 7

Product Details anti-Kallikrein 7 Antibody Application Details Handling Images back to top
Alternative Name Kallikrein 7 (KLK7 Antibody Abstract)
Background Gene Symbol: KLK7
Gene ID 5650
UniProt P49862
Pathways Complement System

Application Details

Product Details anti-Kallikrein 7 Antibody Target Details Kallikrein 7 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Kallikrein 7 Antibody Target Details Kallikrein 7 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-Kallikrein 7 Antibody Target Details Kallikrein 7 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Kallikrein 7 antibody (KLK7) (ABIN4328116) Western Blot: Kallikrein 7 Antibody [NBP2-38950] - Lane 1: Marker [kDa] 250, 130, 95,...
Immunohistochemistry (IHC) image for anti-Kallikrein 7 antibody (KLK7) (ABIN4328116) Immunohistochemistry: Kallikrein 7 Antibody [NBP2-38950] - Staining of human bone mar...