anti-Human LEF1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended LEF1 Antibody (supplied by: Log in to see )

Antigen
Lymphoid Enhancer-Binding Factor 1 (LEF1) Antibodies
  • LEF1
  • 3000002B05
  • AI451430
  • Lef-1
  • LEF-1
  • TCF10
  • TCF1ALPHA
  • TCF7L3
  • lymphoid enhancer-binding factor 1
  • lymphocyte enhancer binding factor 1
  • lymphoid enhancer binding factor 1
  • lymphoid enhancer factor XLEF-1B
  • LEF1
  • LOC100352691
  • lef1
  • Lef1
Reactivity
Human
122
40
32
11
7
7
5
5
4
4
4
4
3
2
1
1
Host
Rabbit
53
49
16
5
Clonality
Polyclonal
Conjugate
This LEF1 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
110
66
20
14
7
6
4
3
2
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4330626
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.850952 ABIN735248 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 3
13.850952 ABIN214792 IHC (p) WB Rabbit AA 51-100 Log in to see Polyclonal
1 ABIN1387756 IF (p) IHC (p) WB Rabbit IgG pSer42 Log in to see Polyclonal 1
1 ABIN202428 IHC (p) WB Rabbit IgG AA 282-331 Log in to see Polyclonal
1 ABIN264379 IF IHC (p) WB Mouse IgG1 Log in to see REMB1
1 ABIN1909578 IF IP IHC (p) WB Rabbit IgG AA 349-399 Log in to see Polyclonal
1 ABIN5564031 FACS IHC (p) Rabbit Log in to see SP308

Top referenced anti-LEF1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-LEF1 Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 2 Antibodies
ELISA 66 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 4 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunofluorescence (IF) 21 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 2 Antibodies
Immunohistochemistry (IHC) 15 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 8 Antibodies
Immunoprecipitation (IP) 3 Antibodies
RNA Interference (RNAi) 1 Antibodies
Western Blotting (WB) 110 Antibodies

General

Antigen Lymphoid Enhancer-Binding Factor 1 (LEF1) Antibodies
Reactivity Human
(122), (40), (32), (11), (7), (7), (5), (5), (4), (4), (4), (4), (3), (2), (1), (1)
Host Rabbit
(53), (49), (16), (5)
Clonality
Polyclonal
Conjugate This LEF1 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(110), (66), (20), (14), (7), (6), (4), (3), (2), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-LEF1 Antibody

Target Details LEF1 Application Details Handling ProductDetails: References for anti-LEF1 antibody (ABIN4330626) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Isotype IgG

Target Details LEF1

Product Details anti-LEF1 Antibody Application Details Handling ProductDetails: References for anti-LEF1 antibody (ABIN4330626) Images back to top
Antigen
Alternative Name LEF1 (LEF1 Antibody Abstract)
Background Gene Symbol: LEF1
Gene ID 51176
Research Area Lineage Markers, Transcription Factors, Wnt
Pathways WNT Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Hormone Metabolic Process, Nuclear Hormone Receptor Binding, Chromatin Binding

Application Details

Product Details anti-LEF1 Antibody Target Details LEF1 Handling ProductDetails: References for anti-LEF1 antibody (ABIN4330626) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-LEF1 Antibody Target Details LEF1 Application Details ProductDetails: References for anti-LEF1 antibody (ABIN4330626) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-LEF1 antibody (ABIN4330626)

Product Details anti-LEF1 Antibody Target Details LEF1 Application Details Handling Images back to top
Product cited in:

Asplund, Gry Björklund, Sundquist, Strömberg, Edlund, Ostman, Nilsson, Pontén, Lundeberg: "Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma." in: The British journal of dermatology, Vol. 158, Issue 3, pp. 527-38, 2008

Images

Product Details anti-LEF1 Antibody Target Details LEF1 Application Details Handling ProductDetails: References for anti-LEF1 antibody (ABIN4330626) back to top
Supplier Images
Western Blotting (WB) image for anti-LEF1 antibody (Lymphoid Enhancer-Binding Factor 1) (ABIN4330626) Western Blot: LEF1 Antibody [NBP1-86960] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-LEF1 antibody (Lymphoid Enhancer-Binding Factor 1) (ABIN4330626) Immunocytochemistry/Immunofluorescence: LEF1 Antibody [NBP1-86960] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LEF1 antibody (Lymphoid Enhancer-Binding Factor 1) (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human lymph n...