You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) PTPN6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PTPN6 Antibody (supplied by: Log in to see )

Antigen
Protein-tyrosine Phosphatase 1C (PTPN6) Antibodies
  • SHP
  • SHP-1
  • Shp1
  • HCP
  • HCPH
  • HPTP1C
  • PTP-1C
  • SH-PTP1
  • SHP-1L
  • SHP1
  • Hcph
  • Ptp1C
  • hcp
  • me
  • motheaten
  • Ptph6
  • Shp-1
  • DRPLA
  • protein tyrosine phosphatase, non-receptor type 6
  • nuclear receptor subfamily 0, group B, member 2
  • PTPN6
  • Nr0b2
  • Ptpn6
Reactivity
Human, Rat (Rattus)
183
90
84
6
3
1
1
1
1
1
1
Host
Rabbit
118
33
33
Clonality
Polyclonal
Conjugate
This PTPN6 antibody is un-conjugated
7
7
7
3
3
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
134
77
54
29
29
27
10
7
6
5
4
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4348608
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.701424 ABIN442153 IHC IHC (p) IP WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN197592 IF IHC (p) WB Rabbit Tyr536 Log in to see Polyclonal 4
1 ABIN319255 IF IHC (p) Rabbit pTyr536 Log in to see Polyclonal 4
1 ABIN271911 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN1103855 IHC (p) ELISA WB Goat AA 553-564 Log in to see Polyclonal
1 ABIN1738601 IHC (p) ELISA WB Goat Internal Region Log in to see Polyclonal
1 ABIN711641 IF (p) IHC (p) WB Rabbit IgG pSer591 Log in to see Polyclonal
1 ABIN711650 IHC (p) WB HRP Rabbit IgG pSer591 Log in to see Polyclonal
1 ABIN2891668 IHC (p) WB Rabbit Lys530 Log in to see Polyclonal
1 ABIN2884340 ELISA IHC (p) WB Rabbit IgG pTyr536 Log in to see Polyclonal
1 ABIN711643 IHC (p) WB Biotin Rabbit IgG pSer591 Log in to see Polyclonal
1 ABIN738090 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1959784 IF IHC (p) Rabbit pTyr536 Log in to see Polyclonal
1 ABIN738083 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN738081 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-PTPN6 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PTPN6 Antibodies

Application / Reactivity Rat (Rattus) Human
ELISA 19 Antibodies 76 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 8 Antibodies
Immunofluorescence (IF) 18 Antibodies 28 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 2 Antibodies 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 26 Antibodies 29 Antibodies
Immunohistochemistry (IHC) 40 Antibodies 55 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 16 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 49 Antibodies
Enzyme Immunoassay (EIA) 6 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Immunochromatography (IC) 1 Antibodies

General

Antigen Protein-tyrosine Phosphatase 1C (PTPN6) Antibodies
Reactivity Human, Rat (Rattus)
(183), (90), (84), (6), (3), (1), (1), (1), (1), (1), (1)
Host Rabbit
(118), (33), (33)
Clonality
Polyclonal
Conjugate This PTPN6 antibody is un-conjugated
(7), (7), (7), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(134), (77), (54), (29), (29), (27), (10), (7), (6), (5), (4), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PTPN6 Antibody

Target Details PTPN6 Application Details Handling References for anti-PTPN6 Antibody (ABIN4348608) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLK
Isotype IgG

Target Details PTPN6

Product Details anti-PTPN6 Antibody Application Details Handling References for anti-PTPN6 Antibody (ABIN4348608) Images back to top
Antigen
Alternative Name PTPN6 (PTPN6 Antibody Abstract)
Background Gene Symbol: PTPN6
Gene ID 5777
Pathways JAK-STAT Signaling, TLR Signaling, Nuclear Receptor Transcription Pathway, Positive Regulation of Peptide Hormone Secretion, Steroid Hormone Mediated Signaling Pathway, Response to Growth Hormone Stimulus, Regulation of Leukocyte Mediated Immunity

Application Details

Product Details anti-PTPN6 Antibody Target Details PTPN6 Handling References for anti-PTPN6 Antibody (ABIN4348608) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PTPN6 Antibody Target Details PTPN6 Application Details References for anti-PTPN6 Antibody (ABIN4348608) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PTPN6 Antibody (ABIN4348608)

Product Details anti-PTPN6 Antibody Target Details PTPN6 Application Details Handling Images back to top
Product cited in:

McKenzie, Jones, Tosi, Caesar, Whittaker, Mitchell: "Constitutive activation of STAT3 in Sézary syndrome is independent of SHP-1." in: Leukemia, Vol. 26, Issue 2, pp. 323-31, 2012

Images

Product Details anti-PTPN6 Antibody Target Details PTPN6 Application Details Handling References for anti-PTPN6 Antibody (ABIN4348608) back to top
Supplier Images
Immunofluorescence (IF) image for anti-PTPN6 antibody (Protein-tyrosine Phosphatase 1C) (ABIN4348608) Immunocytochemistry/Immunofluorescence: PTPN6 Antibody [NBP1-83276] - Staining of hum...
Western Blotting (WB) image for anti-PTPN6 antibody (Protein-tyrosine Phosphatase 1C) (ABIN4348608) Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PTPN6 antibody (Protein-tyrosine Phosphatase 1C) (ABIN4348608) Immunohistochemistry-Paraffin: PTPN6 Antibody [NBP1-83276] - Staining of human lymph ...
Western Blotting (WB) image for anti-PTPN6 antibody (Protein-tyrosine Phosphatase 1C) (ABIN4348608) Western Blot: PTPN6 Antibody [NBP1-83276] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32...