You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Cow (Bovine) STAT3 antibody for Immunocytochemistry

Recommended STAT3 Antibody (supplied by: Log in to see )

Antigen
Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
  • 1110034C02Rik
  • AW109958
  • Aprf
  • APRF
  • HIES
  • Xstat3
  • aprf
  • hies
  • stat3
  • wu:fc15d02
  • wu:fl59g06
  • z-Stat3
  • signal transducer and activator of transcription 3 (acute-phase response factor)
  • signal transduction and activation of transcription 3
  • signal transducer and activator of transcription 3
  • signal transducer and activator of transcription 3 (acute-phase response factor), gene 1
  • STAT3
  • stat3
  • Stat3
  • stat3.1
Epitope
AA 688-722
110
84
71
25
18
17
17
16
15
14
13
11
6
5
5
5
5
4
4
4
4
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Cow (Bovine), Hamster, Horse (Equine), Human, Monkey, Mouse (Murine), Pig (Porcine), Rat (Rattus)
559
331
260
39
36
33
28
16
11
9
7
5
5
4
4
3
3
2
1
1
1
1
1
Host
Rabbit
439
123
34
5
1
1
Clonality
Polyclonal
Conjugate
This STAT3 antibody is un-conjugated
25
22
18
14
11
11
7
5
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Gel Shift (GS), Immunocytochemistry (ICC), Immunoprecipitation (IP), Western Blotting (WB)
516
233
216
82
76
75
53
50
27
12
12
9
8
6
5
3
3
2
2
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN210643
$ 793.83
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1174968 ICC IHC IP WB Rabbit IgG AA 563-670 Log in to see Polyclonal
1 ABIN217053 ICC IP ELISA WB Rabbit pSer727 Log in to see Polyclonal
1 ABIN2628839 ICC IF IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal
1 ABIN5014320 ICC IHC IP WB Rabbit IgG AA 576-678 Log in to see Polyclonal

Similar anti-STAT3 Antibodies

Application / Reactivity Human Mouse (Murine) Monkey Rat (Rattus) Cow (Bovine) Pig (Porcine) Hamster Horse (Equine)
Immunofluorescence (fixed cells) (IF/ICC) 4 Antibodies 4 Antibodies 2 Antibodies 4 Antibodies 2 Antibodies 1 Antibodies
Western Blotting (WB) 474 Antibodies 263 Antibodies 204 Antibodies 31 Antibodies 23 Antibodies 28 Antibodies 5 Antibodies 9 Antibodies
Proximity Ligation Assay (PLA) 3 Antibodies 1 Antibodies 1 Antibodies 1 Antibodies 1 Antibodies 1 Antibodies

General

Antigen Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
Epitope AA 688-722
(110), (84), (71), (25), (18), (17), (17), (16), (15), (14), (13), (11), (6), (5), (5), (5), (5), (4), (4), (4), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Cow (Bovine), Hamster, Horse (Equine), Human, Monkey, Mouse (Murine), Pig (Porcine), Rat (Rattus)
(559), (331), (260), (39), (36), (33), (28), (16), (11), (9), (7), (5), (5), (4), (4), (3), (3), (2), (1), (1), (1), (1), (1)
Host Rabbit
(439), (123), (34), (5), (1), (1)
Clonality
Polyclonal
Conjugate This STAT3 antibody is un-conjugated
(25), (22), (18), (14), (11), (11), (7), (5), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Gel Shift (GS), Immunocytochemistry (ICC), Immunoprecipitation (IP), Western Blotting (WB)
(516), (233), (216), (82), (76), (75), (53), (50), (27), (12), (12), (9), (8), (6), (5), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-STAT3 Antibody

Target Details STAT3 Application Details Handling Images
Specificity Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
Predicted Reactivity Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%) Sheep (97%) Chicken (84%).
Purification Protein A purified
Immunogen Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%), Sheep (97%), Chicken (84%).

Type of Immunogen: Fusion protein
Isotype IgG

Target Details STAT3

Product Details anti-STAT3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name STAT3 (STAT3 Antibody Abstract)
Background Name/Gene ID: STAT3

Synonyms: STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES
Gene ID 6774
UniProt P40763
Research Area Embryogenesis, Embryonic stem cells, Transcription Factors, Signaling, Receptors, Inflammation
Pathways JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Neurotrophin Signaling Pathway, Dopaminergic Neurogenesis, Response to Growth Hormone Stimulus, Carbohydrate Homeostasis, Stem Cell Maintenance, Hepatitis C, Protein targeting to Nucleus, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling of Hepatocyte Growth Factor Receptor

Application Details

Product Details anti-STAT3 Antibody Target Details STAT3 Handling Images back to top
Application Notes Approved: GS, ICC (10 μg/mL), IP, WB (2 - 4 μg/mL)

Usage: Suitable for use in Western Blot, Immunocytochemistry and Immunoprecipitation. Western Blot: 2-4 μg/mL detects STAT3 in RIPA lysates from EGF stimulated human A431 cells. EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2 μg/mL). Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system. Immunocytochemistry: 10 μg/mL shows positive immunostaining for STAT 3 in A431 cells fixed with 95 % ethanol, 5 % acetic acid. Immunoprecipitation: 4 μg immunoprecipitates STAT 3 from 500 μg of EGF-stimulated A431 RIPA lysate. Gel Shift Assay: This antibody supershifts.
Restrictions For Research Use only

Handling

Product Details anti-STAT3 Antibody Target Details STAT3 Application Details Images back to top
Format Liquid
Concentration Lot specific
Buffer 0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05 % sodium azide, 40 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C,-20 °C
Storage Comment Long term: -20°C
Short term: +4°C. Avoid repeat freeze-thaw cycles.