You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human STAT3 antibody for Gel Shift

Recommended STAT3 Antibody (supplied by: Log in to see )

Antigen
Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
  • 1110034C02Rik
  • APRF
  • Aprf
  • aprf
  • AW109958
  • hies
  • HIES
  • stat3
  • wu:fc15d02
  • wu:fl59g06
  • Xstat3
  • z-Stat3
Epitope
AA 688-722
112
95
85
28
21
17
16
16
14
13
13
13
8
5
5
5
5
4
4
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
545
267
209
30
24
24
13
11
10
5
4
3
3
2
2
2
2
1
1
1
1
1
Host
Rabbit
465
109
35
4
1
1
Clonality
Polyclonal
Conjugate
This STAT3 antibody is un-conjugated
24
22
18
13
12
11
8
5
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Application
Gel Shift (GS), Immunocytochemistry (ICC), Immunoprecipitation (IP), Western Blotting (WB)
503
239
217
81
76
69
52
32
23
13
12
12
9
7
3
2
2
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN210643
$ 793.83
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008709465 ABIN218707 GS WB Rabbit IgG C-Term Log in to see Polyclonal

Similar anti-STAT3 Antibodies

Application / Reactivity Human
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 5 Antibodies
ELISA 204 Antibodies
Enzyme Immunoassay (EIA) 12 Antibodies
Flow Cytometry (FACS) 25 Antibodies
Gel Shift (GS) 2 Antibodies
Immunoassay (IA) 2 Antibodies
Immunochromatography (IC) 7 Antibodies
Immunocytochemistry (ICC) 44 Antibodies
Immunodiffusion (ID) 1 Antibodies
Immunofluorescence (IF) 78 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 23 Antibodies
Immunohistochemistry (IHC) 206 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 1 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 2 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 7 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 71 Antibodies

General

Antigen Signal Transducer and Activator of Transcription 3 (Acute-Phase Response Factor) (STAT3) Antibodies
Epitope AA 688-722
(112), (95), (85), (28), (21), (17), (16), (16), (14), (13), (13), (13), (8), (5), (5), (5), (5), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human
(545), (267), (209), (30), (24), (24), (13), (11), (10), (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(465), (109), (35), (4), (1), (1)
Clonality
Polyclonal
Conjugate This STAT3 antibody is un-conjugated
(24), (22), (18), (13), (12), (11), (8), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Gel Shift (GS), Immunocytochemistry (ICC), Immunoprecipitation (IP), Western Blotting (WB)
(503), (239), (217), (81), (76), (69), (52), (32), (23), (13), (12), (12), (9), (7), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-STAT3 Antibody

Target Details STAT3 Application Details Handling Images
Specificity Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
Cross-Reactivity Mouse (Murine), Rat (Rattus)
Predicted Reactivity Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%) Sheep (97%) Chicken (84%).
Purification Protein A Column
Immunogen Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Isotype IgG

Target Details STAT3

Product Details anti-STAT3 Antibody Application Details Handling Images back to top
Antigen
Alternative Name STAT3 (STAT3 Antibody Abstract)
Background Standard Gene Symbol: STAT3, Synonyms: STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES
Gene ID 6774
UniProt P40763
Research Area Embryogenesis, Embryonic stem cells, Transcription Factors, Signaling, Receptors, Inflammation
Pathways JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-STAT3 Antibody Target Details STAT3 Handling Images back to top
Application Notes GS, ICC (10 µg/mL), IP, WB (2 - 4 µg/mL)
Restrictions For Research Use only

Handling

Product Details anti-STAT3 Antibody Target Details STAT3 Application Details Images back to top
Format Liquid
Buffer 0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeat freeze-thaw cycles.
Storage 4 °C/-20 °C
Storage Comment Long term: -20°C, Short term: +4°C, Avoid freeze-thaw cycles.