You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PAK1 antibody for Immunocytochemistry

Recommended PAK1 Antibody (supplied by: Log in to see )

Antigen
P21-Activated Kinase 1 (PAK1) Antibodies
  • X-PAK1
  • XPak1
  • pak
  • pak-1
  • pakalpha
  • PAKalpha
  • AW045634
  • PAK-1
  • Paka
  • p21 protein (Cdc42/Rac)-activated kinase 1
  • Protein PAK-1
  • pak1
  • PAK1
  • Pak1
  • pak-1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
325
156
152
4
4
1
1
Host
Rabbit
293
17
17
1
Clonality
Polyclonal
Conjugate
This PAK1 antibody is un-conjugated
11
11
11
7
7
7
4
4
4
4
4
4
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
228
126
126
57
53
44
22
22
15
7
6
4
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4343458
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2855705 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN1874025 ICC IP IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4343459 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN2405452 ICC IP IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN4343457 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2743439 ICC Rabbit Internal Region Log in to see Polyclonal
1 ABIN2743440 ICC Rabbit pThr212 Log in to see Polyclonal
1 ABIN1844645 ICC IF IHC WB Rabbit Log in to see Polyclonal
1 ABIN1982259 ICC Sheep IgG AA 128-242 Log in to see Polyclonal
1 ABIN2987547 ICC IF IHC WB Rabbit IgG pThr212 Log in to see Polyclonal
1 ABIN3023361 ICC IP IHC WB Rabbit Log in to see Polyclonal
1 ABIN2973990 ICC IF IP IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN2971645 ICC IF IHC WB Rabbit Center, pThr212 Log in to see Polyclonal
1 ABIN2971647 ICC IF IHC WB Rabbit Center Log in to see Polyclonal
1 ABIN2859027 ICC IF IHC WB Rabbit Log in to see Polyclonal

Top referenced anti-PAK1 antibody for Immunocytochemistry

Similar anti-PAK1 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 34 Antibodies 34 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies
Immunochromatography (IC) 3 Antibodies 3 Antibodies
Immunocytochemistry (ICC) 12 Antibodies 12 Antibodies
Immunofluorescence (IF) 37 Antibodies 37 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 44 Antibodies 44 Antibodies
Immunohistochemistry (IHC) 68 Antibodies 69 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 30 Antibodies 30 Antibodies
Immunoprecipitation (IP) 4 Antibodies
Western Blotting (WB) 99 Antibodies

General

Antigen P21-Activated Kinase 1 (PAK1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(325), (156), (152), (4), (4), (1), (1)
Host Rabbit
(293), (17), (17), (1)
Clonality
Polyclonal
Conjugate This PAK1 antibody is un-conjugated
(11), (11), (11), (7), (7), (7), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(228), (126), (126), (57), (53), (44), (22), (22), (15), (7), (6), (4), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PAK1 Antibody

Target Details PAK1 Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
Isotype IgG

Target Details PAK1

Product Details anti-PAK1 Antibody Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Antigen
Alternative Name PAK1 (PAK1 Antibody Abstract)
Background Gene Symbol: PAK1
Gene ID 5058
Research Area Kinases/Phosphatases, Apoptosis/Necrosis, Cancer
Pathways MAPK Signaling, RTK Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway

Application Details

Product Details anti-PAK1 Antibody Target Details PAK1 Handling References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PAK1 Antibody (ABIN4343458)

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details Handling Images back to top
Product cited in:

Geiger, Velic, Macek, Lundberg, Kampf, Nagaraj, Uhlen, Cox, Mann: "Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse." in: Molecular & cellular proteomics : MCP, Vol. 12, Issue 6, pp. 1709-22, 2013

Images

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) back to top
Supplier Images
Immunofluorescence (IF) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Immunocytochemistry/Immunofluorescence: PAK1 Antibody [NBP1-85802] - Staining of huma...
Western Blotting (WB) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Western Blot: PAK1 Antibody [NBP1-85802] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32,...
Western Blotting (WB) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Western Blot: PAK1 Antibody [NBP1-85802] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Immunohistochemistry-Paraffin: PAK1 Antibody [NBP1-85802] - Staining of human cerebra...