You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) PAK1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PAK1 Antibody (supplied by: Log in to see )

Antigen
P21-Activated Kinase 1 (PAK1) Antibodies
  • X-PAK1
  • XPak1
  • pak
  • pak-1
  • pakalpha
  • PAKalpha
  • AW045634
  • PAK-1
  • Paka
  • p21 protein (Cdc42/Rac)-activated kinase 1
  • Protein PAK-1
  • pak1
  • PAK1
  • Pak1
  • pak-1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
329
187
178
8
8
6
5
4
4
3
2
1
1
Host
Rabbit
295
17
16
1
Clonality
Polyclonal
Conjugate
This PAK1 antibody is un-conjugated
11
11
11
7
7
7
4
4
4
4
4
4
4
4
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
235
119
112
66
52
50
23
20
11
7
6
5
4
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4343458
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.823659 ABIN498797 IHC (p) Rabbit pThr402, pThr423 Log in to see Polyclonal
12.823659 ABIN498222 IHC (p) Rabbit Log in to see Polyclonal
12.823659 ABIN498888 IHC (p) WB Rabbit Log in to see Polyclonal
12.823659 ABIN498954 IF IHC (p) WB Rabbit Log in to see Polyclonal
12.823659 ABIN499018 IHC (p) WB Rabbit Log in to see Polyclonal
12.823659 ABIN4343459 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
12.823659 ABIN679148 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
12.823659 ABIN4343457 ICC IF IHC IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN197378 IF IHC (p) Rabbit Thr423 Log in to see Polyclonal 4
1 ABIN196896 IF IHC (p) Rabbit pThr402, pThr421, pThr423 Log in to see Polyclonal 4
1 ABIN196878 IF IHC (p) WB Rabbit pThr212 Log in to see Polyclonal 3
1 ABIN197364 IF IHC (p) WB Rabbit Thr212 Log in to see Polyclonal 3
1 ABIN272055 IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN272054 EIA IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2855705 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN373752 IHC (p) WB Rabbit AA 525-545 Log in to see Polyclonal
1 ABIN2879047 IF IHC (p) ELISA WB Rabbit IgG AA 165-214 Log in to see Polyclonal
1 ABIN2879005 IF IHC (p) ELISA WB Rabbit IgG AA 178-227 Log in to see Polyclonal
1 ABIN2889112 IHC (p) ELISA WB Rabbit IgG AA 170-219 Log in to see Polyclonal
1 ABIN1737823 IF IHC (p) ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal

Top referenced anti-PAK1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-PAK1 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine)
ELISA 39 Antibodies 40 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies 1 Antibodies
Immunochromatography (IC) 3 Antibodies 3 Antibodies
Immunocytochemistry (ICC) 10 Antibodies 10 Antibodies
Immunofluorescence (IF) 34 Antibodies 34 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies 5 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 52 Antibodies 52 Antibodies
Immunohistochemistry (IHC) 66 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 48 Antibodies
Immunoprecipitation (IP) 7 Antibodies
Western Blotting (WB) 118 Antibodies

General

Antigen P21-Activated Kinase 1 (PAK1) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(329), (187), (178), (8), (8), (6), (5), (4), (4), (3), (2), (1), (1)
Host Rabbit
(295), (17), (16), (1)
Clonality
Polyclonal
Conjugate This PAK1 antibody is un-conjugated
(11), (11), (11), (7), (7), (7), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(235), (119), (112), (66), (52), (50), (23), (20), (11), (7), (6), (5), (4), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PAK1 Antibody

Target Details PAK1 Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEE
Isotype IgG

Target Details PAK1

Product Details anti-PAK1 Antibody Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Antigen
Alternative Name PAK1 (PAK1 Antibody Abstract)
Background Gene Symbol: PAK1
Gene ID 5058
Research Area Kinases/Phosphatases, Apoptosis/Necrosis, Cancer
Pathways MAPK Signaling, RTK Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Embryonic Body Morphogenesis

Application Details

Product Details anti-PAK1 Antibody Target Details PAK1 Handling References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details References for anti-PAK1 Antibody (ABIN4343458) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PAK1 Antibody (ABIN4343458)

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details Handling Images back to top
Product cited in:

Geiger, Velic, Macek, Lundberg, Kampf, Nagaraj, Uhlen, Cox, Mann: "Initial quantitative proteomic map of 28 mouse tissues using the SILAC mouse." in: Molecular & cellular proteomics : MCP, Vol. 12, Issue 6, pp. 1709-22, 2013

Images

Product Details anti-PAK1 Antibody Target Details PAK1 Application Details Handling References for anti-PAK1 Antibody (ABIN4343458) back to top
Supplier Images
Immunofluorescence (IF) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Immunocytochemistry/Immunofluorescence: PAK1 Antibody [NBP1-85802] - Staining of huma...
Western Blotting (WB) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Western Blot: PAK1 Antibody [NBP1-85802] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32,...
Western Blotting (WB) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Western Blot: PAK1 Antibody [NBP1-85802] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-PAK1 antibody (P21-Activated Kinase 1) (ABIN4343458) Immunohistochemistry-Paraffin: PAK1 Antibody [NBP1-85802] - Staining of human cerebra...