You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Kinesin Heavy Chain Member 2A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Kinesin Heavy Chain Member 2A Antibody (supplied by: Log in to see )

Antigen
Kinesin Heavy Chain Member 2A (KIF2A) Antibodies
  • fj55b02
  • wu:fj55b02
  • C530030B14Rik
  • Kif2
  • Kns2
  • M-kinesin
  • HK2
  • KIF2
  • kif2-a
  • kinesin-II
  • kns2
  • zgc:103670
  • Kinesin-2
  • kinesin family member 2A
  • kinesin heavy chain member 2A
  • kinesin light chain 1
  • zgc:103670
  • GL50803_17333
  • GL50803_16456
  • Kif2a
  • KIF2A
  • kif2a
  • Klc1
  • klc1
Reactivity
Human, Rat (Rattus)
40
21
20
8
7
6
5
5
4
3
2
2
2
2
2
1
1
Host
Rabbit
28
12
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
35
19
16
7
6
5
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4328837
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.763483 ABIN395518 IHC (p) ELISA WB Mouse IgG1 kappa AA 1-680 Log in to see 2D4
1 ABIN561592 IHC (p) ELISA WB Mouse IgG1 kappa AA 1-679, full length Log in to see 2D4 1
1 ABIN958997 IHC (p) WB Rabbit AA 72-121 Log in to see Polyclonal
1 ABIN2611446 ELISA IHC (p) WB Mouse IgG1 AA 1-680 Log in to see
1 ABIN2475223 IHC (p) Mouse IgG1 AA 1-680 Log in to see 2D4

Top referenced anti-Kinesin Heavy Chain Member 2A antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-Kinesin Heavy Chain Member 2A Antibodies

Application / Reactivity Rat (Rattus) Human
ELISA 6 Antibodies 19 Antibodies
Immunochromatography (IC) 1 Antibodies 1 Antibodies
Immunocytochemistry (ICC) 1 Antibodies 3 Antibodies
Immunofluorescence (IF) 3 Antibodies 6 Antibodies
Immunohistochemistry (IHC) 7 Antibodies 17 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies 6 Antibodies
Immunoprecipitation (IP) 4 Antibodies 7 Antibodies
Simple Western (SimWes) 1 Antibodies 1 Antibodies
Western Blotting (WB) 18 Antibodies 36 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies

General

Antigen Kinesin Heavy Chain Member 2A (KIF2A) Antibodies
Reactivity Human, Rat (Rattus)
(40), (21), (20), (8), (7), (6), (5), (5), (4), (3), (2), (2), (2), (2), (2), (1), (1)
Host Rabbit
(28), (12)
Clonality
Polyclonal
Conjugate Un-conjugated
(1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(35), (19), (16), (7), (6), (5), (3), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product details

Target details Application Details Handling References Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQA
Isotype IgG

Target details

Product details Application Details Handling References Images back to top
Antigen
Alternative Name Kif2a (KIF2A Antibody Abstract)
Background Gene Symbol: KIF2A
Gene ID 3796
Research Area Signaling, Cytoskeleton
Pathways Microtubule Dynamics, Ribonucleoprotein Complex Subunit Organization

Application Details

Product details Target details Handling References Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target details Application Details References Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References

Product details Target details Application Details Handling Images back to top
Product cited in:

Jakobsen, Vanselow, Skogs, Toyoda, Lundberg, Poser, Falkenby, Bennetzen, Westendorf, Nigg, Uhlen, Hyman, Andersen: "Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods." in: The EMBO journal, Vol. 30, Issue 8, pp. 1520-35, 2011

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Images

Product details Target details Application Details Handling References back to top
Supplier Images
Western Blotting (WB) image for anti-Kinesin Heavy Chain Member 2A (KIF2A) antibody (ABIN4328837) Western Blot: Kif2a Antibody [NBP1-83253] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Kinesin Heavy Chain Member 2A (KIF2A) antibody (ABIN4328837) Immunohistochemistry-Paraffin: Kif2a Antibody [NBP1-83253] - Immunohistochemical stai...
Western Blotting (WB) image for anti-Kinesin Heavy Chain Member 2A (KIF2A) antibody (ABIN4328837) Western Blot: Kif2a Antibody [NBP1-83253] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32...