anti-Human NFKBIZ antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended NFKBIZ Antibody (supplied by: Log in to see )

Antigen
Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) Antibodies
  • RGD1310834
  • NFKBIZ
  • MAIL
  • AA408868
  • INAP
  • Mail
  • IKBZ
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
  • nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta
  • Nfkbiz
  • NFKBIZ
  • nfkbiz
  • LOC100356473
Reactivity
Human
35
35
19
5
5
4
4
4
2
2
2
2
2
1
Host
Rabbit
45
3
Clonality
Polyclonal
Conjugate
This NFKBIZ antibody is un-conjugated
3
3
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
32
13
10
6
4
3
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4324156
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN902004 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN902011 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN873064 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN5584488 IHC (p) Rabbit IgG Log in to see Polyclonal 1

General

Antigen Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) Antibodies
Reactivity Human
(35), (35), (19), (5), (5), (4), (4), (4), (2), (2), (2), (2), (2), (1)
Host Rabbit
(45), (3)
Clonality
Polyclonal
Conjugate This NFKBIZ antibody is un-conjugated
(3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(32), (13), (10), (6), (4), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-NFKBIZ Antibody

Target Details NFKBIZ Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
Isotype IgG

Target Details NFKBIZ

Product Details anti-NFKBIZ Antibody Application Details Handling Images back to top
Antigen
Alternative Name IKB zeta (NFKBIZ Antibody Abstract)
Background Gene Symbol: NFKBIZ
Gene ID 64332
UniProt Q9BYH8
Research Area Immunology, Cell Cycle, Innate Immunity, Apoptosis/Necrosis
Pathways NF-kappaB Signaling

Application Details

Product Details anti-NFKBIZ Antibody Target Details NFKBIZ Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20Immunohistochemistry retrieval recommended: HIER pH 6
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-NFKBIZ Antibody Target Details NFKBIZ Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-NFKBIZ Antibody Target Details NFKBIZ Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human bon...
Immunohistochemistry (IHC) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry: IKB zeta Antibody [NBP1-89835] - Immunohistochemical staining o...