You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) Tumor Necrosis Factor antibody for Immunochromatography

Recommended Tumor Necrosis Factor Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor (TNF) Antibodies
  • Cachectin
  • cTNF
  • dif
  • DIF
  • RATTNF
  • TNF
  • tnf
  • TNF-a
  • TNF-ALPHA
  • Tnf-alpha
  • tnf-alpha
  • TNF-alpha
  • TNFa
  • TNFA
  • tnfa
  • Tnfa
  • tnfa-like
  • TNFalpha
  • Tnfsf1a
  • TNFSF2
  • tnfsf2
  • xtnf
Epitope
AA 80-235
36
28
25
18
13
12
10
10
10
7
7
6
4
3
3
3
3
3
2
2
2
1
1
1
1
1
1
Reactivity
Mouse (Murine)
705
307
142
55
52
31
31
27
23
18
12
12
8
7
5
4
4
4
3
3
2
2
1
1
1
Host
Rabbit
538
393
157
43
13
9
9
7
4
1
Clonality
Polyclonal
Conjugate
This Tumor Necrosis Factor antibody is un-conjugated
147
83
44
24
20
9
9
7
5
4
4
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
632
586
319
207
120
100
99
86
80
63
56
56
25
25
22
22
15
14
8
8
6
5
5
5
4
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2380185
$ 554.71
Plus shipping costs $45.00

Similar anti-Tumor Necrosis Factor Antibodies

Application / Reactivity Mouse (Murine)
Biochemical Assay (BCA) 2 Antibodies
Blocking Antibody (Inhibition) 7 Antibodies
Blocking Reagent (BR) 3 Antibodies
Dot Blot (DB) 1 Antibodies
ELISA 142 Antibodies
ELISA (Capture) 2 Antibodies
ELISA (Detection) 2 Antibodies
ELISpot 4 Antibodies
ELISpot (Detection) (ELISPOT (Detection)) 1 Antibodies
Enzyme Immunoassay (EIA) 11 Antibodies
FLISA 1 Antibodies
Flow Cytometry (FACS) 107 Antibodies
Functional Studies (Func) 19 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 9 Antibodies
Immunofluorescence (IF) 25 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 48 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 2 Antibodies

General

Antigen Tumor Necrosis Factor (TNF) Antibodies
Epitope AA 80-235
(36), (28), (25), (18), (13), (12), (10), (10), (10), (7), (7), (6), (4), (3), (3), (3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(705), (307), (142), (55), (52), (31), (31), (27), (23), (18), (12), (12), (8), (7), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1)
Host Rabbit
(538), (393), (157), (43), (13), (9), (9), (7), (4), (1)
Clonality
Polyclonal
Conjugate This Tumor Necrosis Factor antibody is un-conjugated
(147), (83), (44), (24), (20), (9), (9), (7), (5), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(632), (586), (319), (207), (120), (100), (99), (86), (80), (63), (56), (56), (25), (25), (22), (22), (15), (14), (8), (8), (6), (5), (5), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-Tumor Necrosis Factor Antibody

Target Details Tumor Necrosis Factor Application Details Handling Images
Sequence MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-LRSSSQNSSD K PVAHVVANHQ VEEQLEWLSQ RANALLANGM DLKDNQLVVP ADGLYLVYSQ VLFKGQGCPD YVLLTHTVSR FAISYQEKVN LLSAVKSPCP KDTPEGAELK PWYEPIYLGG VFQLEKGDQL SAEVNLPKYL DFAESGQVYF GVIAL
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Tumor Necrosis Factor Alpha (TNFa)
Purification Purified by immunoaffinity chromatography.
Immunogen TNFa (Leu80~Leu235), MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-L RSSSQNSSDK PVAHVVANHQ VEEQLEWLSQ RANALLANGM DLKDNQLVVP ADGLYLVYSQ VLFKGQGCPD YVLLTHTVSR FAISYQEKVN LLSAVKSPCP KDTPEGAELK PWYEPIYLGG VFQLEKGDQL SAEVNLPKYL DFAESGQVYF GVIAL
Isotype IgG

Target Details Tumor Necrosis Factor

Product Details anti-Tumor Necrosis Factor Antibody Application Details Handling Images back to top
Antigen
Alternative Name Tumor Necrosis Factor alpha (TNF Antibody Abstract)
Research Area Cytokines, Growth Factors, Receptors, Immunology, Inflammation
Pathways NF-kappaB Signaling, Apoptosis, Caspase Cascade in Apoptosis

Application Details

Product Details anti-Tumor Necrosis Factor Antibody Target Details Tumor Necrosis Factor Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-Tumor Necrosis Factor Antibody Target Details Tumor Necrosis Factor Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C