You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) RPS6KB2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended RPS6KB2 Antibody (supplied by: Log in to see )

Antigen
Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) Antibodies
  • KLS
  • P70-beta
  • P70-beta-1
  • P70-beta-2
  • S6K-beta2
  • S6K2
  • SRK
  • STK14B
  • p70(S6K)-beta
  • p70S6Kb
  • 70kDa
  • ribosomal protein S6 kinase, 70kDa, polypeptide 2
  • ribosomal protein S6 kinase, polypeptide 2
  • RPS6KB2
  • Rps6kb2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
225
111
78
Host
Rabbit
206
27
2
Clonality
Polyclonal
Conjugate
This RPS6KB2 antibody is un-conjugated
16
16
15
7
7
7
4
4
4
4
4
4
4
4
4
4
4
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
162
101
54
34
32
21
11
9
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4343182
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.096462 ABIN2178141 IF (p) IHC (p) WB Rabbit IgG pSer370 Log in to see Polyclonal
12.096462 ABIN702850 IF (p) IHC (p) WB Rabbit IgG pThr444, pSer447 Log in to see Polyclonal
1 ABIN1414719 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN701674 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1396842 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN2178164 IHC (p) WB HRP Rabbit IgG pTyr389 Log in to see Polyclonal
1 ABIN701667 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN702859 IHC (p) WB HRP Rabbit IgG pThr444, pSer447 Log in to see Polyclonal
1 ABIN2178158 IHC (p) WB Biotin Rabbit IgG pTyr389 Log in to see Polyclonal
1 ABIN701665 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN702852 IHC (p) WB Biotin Rabbit IgG pThr444, pSer447 Log in to see Polyclonal
1 ABIN1386764 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN2178153 IF (p) IHC (p) WB Rabbit IgG pTyr389 Log in to see Polyclonal

Similar anti-RPS6KB2 Antibodies

Application / Reactivity Rat (Rattus) Mouse (Murine) Human
ELISA 7 Antibodies 26 Antibodies 93 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 53 Antibodies 54 Antibodies
Immunohistochemistry (IHC) 4 Antibodies 6 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 14 Antibodies 16 Antibodies
Immunoprecipitation (IP) 1 Antibodies 1 Antibodies
Western Blotting (WB) 27 Antibodies 58 Antibodies
Flow Cytometry (FACS) 2 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 1 Antibodies
ELISA (Capture) 1 Antibodies

General

Antigen Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(225), (111), (78)
Host Rabbit
(206), (27), (2)
Clonality
Polyclonal
Conjugate This RPS6KB2 antibody is un-conjugated
(16), (16), (15), (7), (7), (7), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(162), (101), (54), (34), (32), (21), (11), (9), (3), (2), (1)
Supplier Log in to see

Product Details anti-RPS6KB2 Antibody

Target Details RPS6KB2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Isotype IgG

Target Details RPS6KB2

Product Details anti-RPS6KB2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name p70 S6 Kinase beta/s6k2 (RPS6KB2 Antibody Abstract)
Background Gene Symbol: RPS6KB2
Gene ID 6199
Pathways PI3K-Akt Signaling, RTK Signaling, AMPK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-RPS6KB2 Antibody Target Details RPS6KB2 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RPS6KB2 Antibody Target Details RPS6KB2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-RPS6KB2 Antibody Target Details RPS6KB2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-RPS6KB2 antibody (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2) (ABIN4343182) Immunohistochemistry-Paraffin: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Immuno...
Western Blotting (WB) image for anti-RPS6KB2 antibody (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2) (ABIN4343182) Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: Marker [kDa] 23...
Western Blotting (WB) image for anti-RPS6KB2 antibody (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2) (ABIN4343182) Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: NIH-3T3 cell ly...