PPARG antibody (Middle Region)
-
- Target See all PPARG Antibodies
- PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))
-
Binding Specificity
- AA 207-248, Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPARG antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Peroxisome proliferator-activated receptor gamma(PPARG) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- AIRFGRMPQA EKEKLLAEIS SDIDQLNPES ADLRALAKHL YD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Peroxisome proliferator-activated receptor gamma(PPARG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: peroxisome proliferator activated receptor gamma
Protein Name: Peroxisome proliferator-activated receptor gamma - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma (207-248aa AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PPARG Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
PIK3R3 regulates PPARα expression to stimulate fatty acid β-oxidation and decrease hepatosteatosis." in: Experimental & molecular medicine, Vol. 50, Issue 1, pp. e431, (2018) (PubMed).
: "Rosiglitazone infusion therapy following minimally invasive surgery for intracerebral hemorrhage evacuation decreases matrix metalloproteinase-9 and blood-brain barrier disruption in rabbits." in: BMC neurology, Vol. 15, pp. 37, (2016) (PubMed).
: "Electrospun poly(L-lactide)/poly(?-caprolactone) blend nanofibrous scaffold: characterization and biocompatibility with human adipose-derived stem cells." in: PLoS ONE, Vol. 8, Issue 8, pp. e71265, (2013) (PubMed).
: "The effect of core decompression on local expression of BMP-2, PPAR-γ and bone regeneration in the steroid-induced femoral head osteonecrosis." in: BMC musculoskeletal disorders, Vol. 13, pp. 142, (2012) (PubMed).
: "Enhanced peroxisomal ?-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice." in: Experimental and therapeutic medicine, Vol. 2, Issue 2, pp. 309-315, (2012) (PubMed).
: "Scorpion in Combination with Gypsum: Novel Antidiabetic Activities in Streptozotocin-Induced Diabetic Mice by Up-Regulating Pancreatic PPARγ and PDX-1 Expressions." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2011, pp. 683561, (2011) (PubMed).
: "
-
PIK3R3 regulates PPARα expression to stimulate fatty acid β-oxidation and decrease hepatosteatosis." in: Experimental & molecular medicine, Vol. 50, Issue 1, pp. e431, (2018) (PubMed).
-
- Target
- PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))
- Alternative Name
- PPARG (PPARG Products)
- Synonyms
- PPAR gamma antibody, PPARg2 antibody, PPARG antibody, Nr1c3 antibody, PPAR-gamma antibody, PPAR-gamma2 antibody, PPARgamma antibody, PPARgamma2 antibody, NR1C3 antibody, CIMT1 antibody, GLM1 antibody, PPARG1 antibody, PPARG2 antibody, xPPAR-gamma antibody, PPAR-GAMMA antibody, PPARGAMMA antibody, peroxisome proliferator-activated receptor gamma antibody, peroxisome proliferator activated receptor gamma antibody, peroxisome proliferator activated receptor gamma L homeolog antibody, PPARG antibody, Pparg antibody, pparg.L antibody
- Background
-
The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.
Synonyms: Peroxisome proliferator-activated receptor gamma, PPAR-gamma, Nuclear receptor subfamily 1 group C member 3, PPARG, NR1C3 - Gene ID
- 5468
- UniProt
- P37231
- Pathways
- MAPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Endopeptidase Activity, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation
-