Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

PPARG antibody (Middle Region)

PPARG Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5518944
  • Target See all PPARG Antibodies
    PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))
    Binding Specificity
    • 21
    • 17
    • 16
    • 16
    • 16
    • 14
    • 9
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 207-248, Middle Region
    Reactivity
    • 152
    • 107
    • 94
    • 34
    • 33
    • 24
    • 22
    • 20
    • 15
    • 10
    • 6
    • 6
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 145
    • 17
    • 3
    • 2
    Rabbit
    Clonality
    • 149
    • 19
    Polyclonal
    Conjugate
    • 81
    • 14
    • 11
    • 7
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 2
    This PPARG antibody is un-conjugated
    Application
    • 150
    • 57
    • 55
    • 52
    • 52
    • 31
    • 20
    • 16
    • 14
    • 13
    • 6
    • 5
    • 5
    • 4
    • 2
    • 1
    Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for Peroxisome proliferator-activated receptor gamma(PPARG) detection. Tested with WB in Human,Mouse,Rat.
    Sequence
    AIRFGRMPQA EKEKLLAEIS SDIDQLNPES ADLRALAKHL YD
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Peroxisome proliferator-activated receptor gamma(PPARG) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: peroxisome proliferator activated receptor gamma
    Protein Name: Peroxisome proliferator-activated receptor gamma
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma (207-248aa AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product PPARG Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Yang, Fu, Hu, Luo, Hu, Wang: "PIK3R3 regulates PPARα expression to stimulate fatty acid β-oxidation and decrease hepatosteatosis." in: Experimental & molecular medicine, Vol. 50, Issue 1, pp. e431, (2018) (PubMed).

    Wu, Wu, Jiao, Wang, Wang, Zhang: "Rosiglitazone infusion therapy following minimally invasive surgery for intracerebral hemorrhage evacuation decreases matrix metalloproteinase-9 and blood-brain barrier disruption in rabbits." in: BMC neurology, Vol. 15, pp. 37, (2016) (PubMed).

    Chen, Bai, Liao, Peng, Wu, Wang, Zeng, Xie: "Electrospun poly(L-lactide)/poly(?-caprolactone) blend nanofibrous scaffold: characterization and biocompatibility with human adipose-derived stem cells." in: PLoS ONE, Vol. 8, Issue 8, pp. e71265, (2013) (PubMed).

    Wang, Liu, Dang, Ma, Zhang, Wang: "The effect of core decompression on local expression of BMP-2, PPAR-γ and bone regeneration in the steroid-induced femoral head osteonecrosis." in: BMC musculoskeletal disorders, Vol. 13, pp. 142, (2012) (PubMed).

    Xie, Wang, Zhang, Li, Can, Qing, Kung, Zhang: "Enhanced peroxisomal ?-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice." in: Experimental and therapeutic medicine, Vol. 2, Issue 2, pp. 309-315, (2012) (PubMed).

    Xie, Zhao, Gu, Du, Cai, Zhang: "Scorpion in Combination with Gypsum: Novel Antidiabetic Activities in Streptozotocin-Induced Diabetic Mice by Up-Regulating Pancreatic PPARγ and PDX-1 Expressions." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2011, pp. 683561, (2011) (PubMed).

  • Target
    PPARG (Peroxisome Proliferator-Activated Receptor gamma (PPARG))
    Alternative Name
    PPARG (PPARG Products)
    Synonyms
    PPAR gamma antibody, PPARg2 antibody, PPARG antibody, Nr1c3 antibody, PPAR-gamma antibody, PPAR-gamma2 antibody, PPARgamma antibody, PPARgamma2 antibody, NR1C3 antibody, CIMT1 antibody, GLM1 antibody, PPARG1 antibody, PPARG2 antibody, xPPAR-gamma antibody, PPAR-GAMMA antibody, PPARGAMMA antibody, peroxisome proliferator-activated receptor gamma antibody, peroxisome proliferator activated receptor gamma antibody, peroxisome proliferator activated receptor gamma L homeolog antibody, PPARG antibody, Pparg antibody, pparg.L antibody
    Background
    The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.

    Synonyms: Peroxisome proliferator-activated receptor gamma, PPAR-gamma, Nuclear receptor subfamily 1 group C member 3, PPARG, NR1C3
    Gene ID
    5468
    UniProt
    P37231
    Pathways
    MAPK Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Endopeptidase Activity, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation
You are here:
Support