You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human Amphiregulin antibody for Immunohistochemistry

Recommended Amphiregulin Antibody (supplied by: Log in to see )

Antigen
Amphiregulin (AREG) Antibodies
  • AR
  • AREG
  • AREG/SDGF
  • AREGB
  • CRDGF
  • SDGF
  • Sdgf
Reactivity
Human
71
16
5
2
1
1
1
Host
Rabbit
62
10
2
2
1
1
Clonality
Polyclonal
Conjugate
This Amphiregulin antibody is un-conjugated
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
48
25
21
15
14
6
5
4
1
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4280428
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.21377301 ABIN2469565 IHC Rabbit AA 8-26 Log in to see Polyclonal
0.001164044 ABIN958036 ICC IHC WB Goat IgG Log in to see Polyclonal
0.001164044 ABIN1871064 IHC WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN315501 IHC (p) IHC Rabbit AA 8-26 Log in to see Polyclonal
0.001164044 ABIN2200224 IHC ELISA Rabbit IgG C-Term Log in to see Polyclonal
0.001164044 ABIN2200233 IC IHC ELISA WB Rabbit IgG AA 20-100 Log in to see Polyclonal
0.001164044 ABIN2879951 IHC Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN2404744 IHC WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN2200234 IP IHC Rabbit IgG AA 8-26 Log in to see Polyclonal
0.001164044 ABIN1981929 ICC IHC WB Sheep IgG AA 107-184 Log in to see Polyclonal
0.001164044 ABIN2895249 IHC Rabbit Log in to see Polyclonal
0.001164044 ABIN1082885 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN1082884 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN2200222 IHC Rabbit AA 8-26 Log in to see Polyclonal
0.001164044 ABIN4280427 IHC IHC (p) Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN4280429 IHC IHC (p) WB Rabbit Log in to see Polyclonal
0.001164044 ABIN2694225 IHC WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN3015640 IHC WB Rabbit Log in to see Polyclonal
0.001164044 ABIN2990490 IHC WB Rabbit IgG Log in to see Polyclonal
0.001164044 ABIN2407996 FACS IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal

Top referenced anti-Amphiregulin antibody for Immunohistochemistry

Similar anti-Amphiregulin Antibodies

Application / Reactivity Human
ELISA 22 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 4 Antibodies
Immunofluorescence (IF) 4 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 22 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 15 Antibodies
Proximity Ligation Assay (PLA) 1 Antibodies
Western Blotting (WB) 43 Antibodies

General

Antigen Amphiregulin (AREG) Antibodies
Reactivity Human
(71), (16), (5), (2), (1), (1), (1)
Host Rabbit
(62), (10), (2), (2), (1), (1)
Clonality
Polyclonal
Conjugate This Amphiregulin antibody is un-conjugated
(1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(48), (25), (21), (15), (14), (6), (5), (4), (1), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-Amphiregulin Antibody

Target Details Amphiregulin Application Details Handling References for anti-Amphiregulin Antibody (ABIN4280428) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC
Isotype IgG

Target Details Amphiregulin

Product Details anti-Amphiregulin Antibody Application Details Handling References for anti-Amphiregulin Antibody (ABIN4280428) Images back to top
Antigen
Alternative Name Amphiregulin (AREG Antibody Abstract)
Background Gene Symbol: AREG
UniProt P15514
Research Area Growth Factors, Cancer
Pathways RTK Signaling, EGFR Signaling Pathway

Application Details

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Handling References for anti-Amphiregulin Antibody (ABIN4280428) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Application Details References for anti-Amphiregulin Antibody (ABIN4280428) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Amphiregulin Antibody (ABIN4280428)

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Application Details Handling Images back to top
Product cited in:

Barton, DAmato, Gordon, Lind, Spoelstra, Babbs, Heinz, Elias, Jedlicka, Jacobsen, Richer: "Multiple molecular subtypes of triple-negative breast cancer critically rely on androgen receptor and respond to enzalutamide in vivo." in: Molecular cancer therapeutics, Vol. 14, Issue 3, pp. 769-78, 2015 (Sample species: Human). Further details: Immunohistochemistry

Images

Product Details anti-Amphiregulin Antibody Target Details Amphiregulin Application Details Handling References for anti-Amphiregulin Antibody (ABIN4280428) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Amphiregulin antibody (AREG) (ABIN4280428) Immunohistochemistry-Paraffin: Amphiregulin Antibody [NBP1-87071] - Staining of human...
Immunohistochemistry (IHC) image for anti-Amphiregulin antibody (AREG) (ABIN4280428) Immunohistochemistry: Amphiregulin Antibody [NBP1-87071] - Immunohistochemical staini...