You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human MERTK antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MERTK Antibody (supplied by: Log in to see )

Antigen
C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) Antibodies
  • C-EYK
  • c-mer
  • DKFZp469D2215
  • Eyk
  • Mer
  • MER
  • MERTK
  • nmf12
  • Nyk
  • rdy
  • RP38
  • si:ch1073-268l12.2
Reactivity
Human
152
45
33
5
1
1
Host
Rabbit
102
27
26
4
Clonality
Polyclonal
Conjugate
This MERTK antibody is un-conjugated
10
7
6
6
5
5
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
103
90
47
14
14
13
11
10
10
8
3
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4333889
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.00089160475 ABIN392017 IHC (p) WB Rabbit Ig AA 6-37, N-Term Log in to see Polyclonal 2
0.00089160475 ABIN392343 FACS IF IHC (p) WB Rabbit Ig Log in to see Polyclonal
0.00089160475 ABIN669966 IF (p) IHC (p) WB Rabbit IgG AA 530-580 Log in to see Polyclonal
0.00089160475 ABIN574370 IHC (p) ELISA Goat C-Term Log in to see Polyclonal
0.00089160475 ABIN669968 IHC (p) WB Biotin Rabbit IgG AA 530-580 Log in to see Polyclonal
0.00089160475 ABIN669975 IHC (p) WB HRP Rabbit IgG AA 530-580 Log in to see Polyclonal
0.00089160475 ABIN1736895 IHC (p) ELISA Goat C-Term Log in to see Polyclonal
0.00089160475 ABIN230690 IHC (p) ELISA WB Mouse IgG1 Log in to see
0.00089160475 ABIN1841174 IHC (p) WB Rabbit N-Term Log in to see Polyclonal
0.00089160475 ABIN1840469 FACS IF IHC (p) WB Rabbit Log in to see Polyclonal
0.00089160475 ABIN1869153 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal
0.00089160475 ABIN2771459 IHC (p) IHC ELISA Goat C-Term Log in to see Polyclonal

Top referenced anti-MERTK antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-MERTK Antibodies

Application / Reactivity Human
Confocal Microscopy (CM) 8 Antibodies
ELISA 90 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 14 Antibodies
Immunocytochemistry (ICC) 11 Antibodies
Immunofluorescence (IF) 15 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 11 Antibodies
Immunohistochemistry (IHC) 47 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 13 Antibodies
Immunoprecipitation (IP) 10 Antibodies
Western Blotting (WB) 100 Antibodies

General

Antigen C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) Antibodies
Reactivity Human
(152), (45), (33), (5), (1), (1)
Host Rabbit
(102), (27), (26), (4)
Clonality
Polyclonal
Conjugate This MERTK antibody is un-conjugated
(10), (7), (6), (6), (5), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(103), (90), (47), (14), (14), (13), (11), (10), (10), (8), (3), (2)
Supplier Log in to see

Product Details anti-MERTK Antibody

Target Details MERTK Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFY
Isotype IgG

Target Details MERTK

Product Details anti-MERTK Antibody Application Details Handling Images back to top
Antigen
Alternative Name Mer (MERTK Antibody Abstract)
Background Gene Symbol: MERTK
Pathways RTK Signaling

Application Details

Product Details anti-MERTK Antibody Target Details MERTK Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MERTK Antibody Target Details MERTK Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MERTK Antibody Target Details MERTK Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-MERTK antibody (C-Mer Proto-Oncogene Tyrosine Kinase) (ABIN4333889) Immunohistochemistry-Paraffin: Mer Antibody [NBP1-82776] - Staining of human pancreas...
Immunofluorescence (IF) image for anti-MERTK antibody (C-Mer Proto-Oncogene Tyrosine Kinase) (ABIN4333889) Immunocytochemistry/Immunofluorescence: Mer Antibody [NBP1-82776] - Staining of human...