anti-Human MERTK antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended MERTK Antibody (supplied by: Log in to see )

Antigen
C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) Antibodies
  • C-EYK
  • MERTK
  • DKFZp469D2215
  • si:ch1073-268l12.2
  • MER
  • RP38
  • c-mer
  • Eyk
  • Mer
  • Nyk
  • nmf12
  • rdy
  • c-mer proto-oncogene tyrosine kinase
  • MERTK
  • LOC100219161
  • mertk
  • Mertk
Reactivity
Human
188
99
44
5
2
2
1
1
1
1
1
Host
Rabbit
114
48
40
36
Clonality
Polyclonal
Conjugate
This MERTK antibody is un-conjugated
13
11
11
9
8
7
7
6
6
6
6
5
5
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
130
95
68
67
28
21
16
14
13
13
10
4
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4333889
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN392017 IHC (p) WB Rabbit Ig AA 6-37, N-Term Log in to see Polyclonal 2
1 ABIN669966 IF (p) IHC (p) WB Rabbit IgG AA 530-580 Log in to see Polyclonal
1 ABIN574370 IHC (p) ELISA Goat AA 990-999 Log in to see Polyclonal
1 ABIN392343 FACS IF IHC (p) WB Rabbit Ig Log in to see Polyclonal
1 ABIN669975 IHC (p) WB HRP Rabbit IgG AA 530-580 Log in to see Polyclonal
1 ABIN669968 IHC (p) WB Biotin Rabbit IgG AA 530-580 Log in to see Polyclonal
1 ABIN1736895 IHC (p) ELISA Goat C-Term Log in to see Polyclonal
1 ABIN2884052 ELISA IHC (p) WB Rabbit IgG pTyr681, pTyr749 Log in to see Polyclonal
1 ABIN2884051 ELISA IHC (p) WB Rabbit IgG AA 716-765 Log in to see Polyclonal
1 ABIN5534530 FACS IF IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal
1 ABIN5583434 IHC (p) WB Rabbit pTyr681, pTyr749 Log in to see Polyclonal
1 ABIN1840469 FACS IF IHC (p) WB Rabbit Log in to see Polyclonal
1 ABIN2771459 IHC (p) IHC ELISA Goat C-Term Log in to see Polyclonal

General

Antigen C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) Antibodies
Reactivity Human
(188), (99), (44), (5), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(114), (48), (40), (36)
Clonality
Polyclonal
Conjugate This MERTK antibody is un-conjugated
(13), (11), (11), (9), (8), (7), (7), (6), (6), (6), (6), (5), (5), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(130), (95), (68), (67), (28), (21), (16), (14), (13), (13), (10), (4), (2), (1)
Supplier Log in to see

Product Details anti-MERTK Antibody

Target Details MERTK Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSISVPNIYQDTTISWWKDGKELLGAHHAITQFY
Isotype IgG

Target Details MERTK

Product Details anti-MERTK Antibody Application Details Handling Images back to top
Antigen
Alternative Name Mer (MERTK Antibody Abstract)
Background Gene Symbol: MERTK
Gene ID 10461
Pathways RTK Signaling

Application Details

Product Details anti-MERTK Antibody Target Details MERTK Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-MERTK Antibody Target Details MERTK Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-MERTK Antibody Target Details MERTK Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) antibody (ABIN4333889) Immunohistochemistry-Paraffin: Mer Antibody [NBP1-82776] - Staining of human pancreas...
Immunofluorescence (IF) image for anti-C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) antibody (ABIN4333889) Immunocytochemistry/Immunofluorescence: Mer Antibody [NBP1-82776] - Staining of human...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) antibody (ABIN4333889) Immunohistochemistry-Paraffin: Mer Antibody - Staining of human lymph node shows mod...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) antibody (ABIN4333889) Immunohistochemistry-Paraffin: Mer Antibody - Staining of human stomach shows modera...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-C-Mer Proto-Oncogene Tyrosine Kinase (MERTK) antibody (ABIN4333889) Immunohistochemistry-Paraffin: Mer Antibody - Staining of human skeletal muscle show...