anti-Mouse (Murine) TGFB1 antibody for Immunocytochemistry

Recommended TGFB1 Antibody (supplied by: Log in to see )

Antigen
Transforming Growth Factor, beta 1 (TGFB1) Antibodies
  • TGF-beta
  • ai39657
  • tgfb1
  • wu:fb13a07
  • xx:ai39657
  • TGFB
  • TGFbeta
  • TGFB1
  • TGFBI
  • csd
  • cdb1
  • cdg2
  • csd1
  • csd2
  • csd3
  • ebmd
  • lcd1
  • bigh3
  • cdgg1
  • betaig-h3
  • MGC146225
  • TGFB4
  • CED
  • DPD1
  • LAP
  • TGF-BETA-1
  • Tgfb
  • TGF-beta1
  • TGFbeta1
  • Tgfb-1
  • TGF-beta5
  • ced
  • dpd1
  • lap
  • tgf-beta
  • tgfb
  • tgfb5
  • tgfbeta
  • tgf
  • transforming growth factor beta-1
  • transforming growth factor, beta 1a
  • transforming growth factor beta 1
  • transforming growth factor beta induced
  • transforming growth factor beta induced L homeolog
  • transforming growth factor, beta 1
  • transforming growth factor beta 1 L homeolog
  • transforming growth factor beta-1-like
  • TGFB1
  • tgfb1a
  • TGFBI
  • tgfbi.L
  • tgfbi
  • Tgfb1
  • tgfb1.L
  • LOC100136774
Reactivity
Human, Mouse (Murine)
347
133
85
29
19
15
12
11
11
11
10
6
6
4
3
3
3
2
2
1
Host
Rabbit
251
190
15
4
3
2
1
Clonality
Polyclonal
Conjugate
This TGFB1 antibody is un-conjugated
35
26
16
16
12
10
9
8
8
8
7
7
6
3
3
3
3
3
3
3
2
2
2
2
2
2
2
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
275
227
135
126
65
42
39
34
17
15
15
13
12
5
4
3
2
2
2
2
2
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Catalog No. ABIN4894442
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2506704 ICC IF IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal
1 ABIN1077717 ICC IHC IP WB Rabbit IgG AA 279-390 Log in to see Polyclonal
1 ABIN1941590 ELISA ICC IF IHC WB APC Rabbit IgG AA 29-58 Log in to see Polyclonal
1 ABIN1941591 ELISA ICC IF IHC WB Alkaline Phosphatase (AP) Rabbit IgG AA 29-58 Log in to see Polyclonal
1 ABIN1941589 ELISA ICC IF IHC WB PE Rabbit IgG AA 29-58 Log in to see Polyclonal
1 ABIN2629083 ICC IF IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal
1 ABIN4905402 ELISA FACS ICC IHC WB Mouse IgG Log in to see

General

Antigen Transforming Growth Factor, beta 1 (TGFB1) Antibodies
Reactivity Human, Mouse (Murine)
(347), (133), (85), (29), (19), (15), (12), (11), (11), (11), (10), (6), (6), (4), (3), (3), (3), (2), (2), (1)
Host Rabbit
(251), (190), (15), (4), (3), (2), (1)
Clonality
Polyclonal
Conjugate This TGFB1 antibody is un-conjugated
(35), (26), (16), (16), (12), (10), (9), (8), (8), (8), (7), (7), (6), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(275), (227), (135), (126), (65), (42), (39), (34), (17), (15), (15), (13), (12), (5), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-TGFB1 Antibody

Target Details TGFB1 Application Details Handling References for anti-TGFB1 antibody (ABIN4894442) Images
Purification Immunogen affinity purified
Immunogen Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS.

Target Details TGFB1

Product Details anti-TGFB1 Antibody Application Details Handling References for anti-TGFB1 antibody (ABIN4894442) Images back to top
Antigen
Alternative Name TGF-beta 1 (TGFB1 Antibody Abstract)
Background Gene Symbol: TGFB1
Molecular Weight Theoretical MW: 43 kDa
Gene ID 7040
NCBI Accession NP_035707
Pathways EGFR Signaling Pathway, Dopaminergic Neurogenesis, Cellular Response to Molecule of Bacterial Origin, Glycosaminoglycan Metabolic Process, Regulation of Leukocyte Mediated Immunity, Regulation of Muscle Cell Differentiation, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus, Autophagy

Application Details

Product Details anti-TGFB1 Antibody Target Details TGFB1 Handling References for anti-TGFB1 antibody (ABIN4894442) Images back to top
Application Notes Western Blot 1:1000-1:5000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 5-10 μg/mL, Immunohistochemistry-Paraffin 5-10 μg/mLThe observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TGFB1 Antibody Target Details TGFB1 Application Details References for anti-TGFB1 antibody (ABIN4894442) Images back to top
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

References for anti-TGFB1 antibody (ABIN4894442)

Product Details anti-TGFB1 Antibody Target Details TGFB1 Application Details Handling Images back to top
Product cited in:

Herrmann, Wohlert, Saguner, Flores, Nesbitt, Chade, Lerman, Lerman: "Primary proteasome inhibition results in cardiac dysfunction." in: European journal of heart failure, Vol. 15, Issue 6, pp. 614-23, 2013 (Sample species: Pig (Porcine)). Further details: Western Blotting