You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human VAV1 antibody for Immunocytochemistry

Recommended VAV1 Antibody (supplied by: Log in to see )

Antigen
Vav 1 Oncogene (VAV1) Antibodies
  • VAV
  • Vav
  • vav-T
Reactivity
Human
142
63
62
1
1
1
Host
Rabbit
126
16
Clonality
Polyclonal
Conjugate
This VAV1 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
120
58
24
12
9
9
8
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN4364879
Contact our Customer Service for availability and price in your country.

Similar anti-VAV1 Antibodies

Application / Reactivity Human
ELISA 58 Antibodies
ELISA (Capture) 1 Antibodies
Flow Cytometry (FACS) 8 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 10 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 12 Antibodies
Immunohistochemistry (IHC) 25 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 10 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Western Blotting (WB) 120 Antibodies

General

Antigen Vav 1 Oncogene (VAV1) Antibodies
Reactivity Human
(142), (63), (62), (1), (1), (1)
Host Rabbit
(126), (16)
Clonality
Polyclonal
Conjugate This VAV1 antibody is un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(120), (58), (24), (12), (9), (9), (8), (3), (1), (1), (1)
Supplier Log in to see

Product Details anti-VAV1 Antibody

Target Details VAV1 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL
Isotype IgG

Target Details VAV1

Product Details anti-VAV1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Vav-1 (VAV1 Antibody Abstract)
Background Gene Symbol: VAV1
Pathways TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-VAV1 Antibody Target Details VAV1 Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-VAV1 Antibody Target Details VAV1 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.