You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) IGFBP4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended IGFBP4 Antibody (supplied by: Log in to see )

Insulin-Like Growth Factor Binding Protein 4 (IGFBP4) Antibodies
  • IGFBP4
  • igfbp4
  • BP-4
  • HT29-IGFBP
  • IBP4
  • IGFBP-4
  • AI875747
  • Deb2
  • IGF-BP4
  • IBP-4
  • insulin-like growth factor binding protein 4
  • IGFBP4
  • igfbp4
  • LOC100194498
  • LOC100225608
  • LOC100271886
  • Igfbp4
  • LOC100337926
Human, Mouse (Murine)
This IGFBP4 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4894624
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN652262 IHC (p) WB Rabbit Ig AA 96-124, Center Log in to see Polyclonal 1
1 ABIN490041 IHC (p) WB Rabbit IgG AA 180-229 Log in to see Polyclonal
1 ABIN1812071 IHC (p) WB Rabbit AA 96-124 Log in to see Polyclonal

Top referenced anti-IGFBP4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

  • Human Polyclonal IGFBP4 Primary Antibody for IHC, IHC (p) - ABIN4894624 (1 Publications): Davila, Laws, Kannan, Li, Taylor, Bagchi, Bagchi: Rac1 Regulates Endometrial Secretory Function to Control Placental Development. in PLoS genetics 2015 (PubMed)

  • Human Polyclonal IGFBP4 Primary Antibody for IHC (p), WB - ABIN652262 (1 Publications): Canzian, Cox, Setiawan, Stram, Ziegler, Dossus, Beckmann, Blanché, Barricarte, Berg, Bingham, Buring, Buys, Calle, Chanock, Clavel-Chapelon, DeLancey, Diver, Dorronsoro, Haiman, Hallmans, Hankinson, Hunter, Hüsing, Isaacs, Khaw, Kolonel, Kraft, Le Marchan: Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium. in Human molecular genetics 2010 (PubMed)

Similar anti-IGFBP4 Antibodies

Application / Reactivity Mouse (Murine) Human
ELISA 118 Antibodies 174 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies 2 Antibodies
Flow Cytometry (FACS) 3 Antibodies 3 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunohistochemistry (IHC) 18 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 4 Antibodies
Immunoprecipitation (IP) 2 Antibodies
Western Blotting (WB) 39 Antibodies
Blocking Peptide (BP) 1 Antibodies
ELISA (Capture) 2 Antibodies
ELISA (Detection) 2 Antibodies
Immunoassay (IA) 3 Antibodies
Immunochromatography (IC) 2 Antibodies


Antigen Insulin-Like Growth Factor Binding Protein 4 (IGFBP4) Antibodies
Reactivity Human, Mouse (Murine)
(205), (138), (20), (7), (5), (3), (3), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(125), (83), (17)
Conjugate This IGFBP4 antibody is un-conjugated
(15), (15), (10), (10), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(190), (110), (40), (9), (9), (7), (5), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-IGFBP4 Antibody

Target Details IGFBP4 Application Details Handling References for anti-IGFBP4 Antibody (ABIN4894624) Images
Purification Immunogen affinity purified
Immunogen Synthetic peptide directed towards the middle region of human IGFBP4. Peptide sequence RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV.

Target Details IGFBP4

Product Details anti-IGFBP4 Antibody Application Details Handling References for anti-IGFBP4 Antibody (ABIN4894624) Images back to top
Alternative Name IGFBP-4 (IGFBP4 Antibody Abstract)
Background Gene Symbol: IGFBP4
Molecular Weight Theoretical MW: 28 kDa
Gene ID 3487
NCBI Accession NP_001543
Pathways WNT Signaling, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process

Application Details

Product Details anti-IGFBP4 Antibody Target Details IGFBP4 Handling References for anti-IGFBP4 Antibody (ABIN4894624) Images back to top
Application Notes Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against IGFBP4 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-IGFBP4 Antibody Target Details IGFBP4 Application Details References for anti-IGFBP4 Antibody (ABIN4894624) Images back to top
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.

References for anti-IGFBP4 Antibody (ABIN4894624)

Product Details anti-IGFBP4 Antibody Target Details IGFBP4 Application Details Handling Images back to top
Product cited in:

Davila, Laws, Kannan, Li, Taylor, Bagchi, Bagchi: "Rac1 Regulates Endometrial Secretory Function to Control Placental Development." in: PLoS genetics, Vol. 11, Issue 8, pp. e1005458, 2015 (Sample species: Mouse (Murine)). Further details: Immunohistochemistry (Frozen Sections)


Product Details anti-IGFBP4 Antibody Target Details IGFBP4 Application Details Handling References for anti-IGFBP4 Antibody (ABIN4894624) back to top
Supplier Images
Western Blotting (WB) image for anti-IGFBP4 antibody (Insulin-Like Growth Factor Binding Protein 4) (ABIN4894624) Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IGFBP4 antibody (Insulin-Like Growth Factor Binding Protein 4) (ABIN4894624) Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue,...