You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human LEF1 antibody for Immunocytochemistry

Recommended LEF1 Antibody (supplied by: Log in to see )

Antigen
Lymphoid Enhancer-Binding Factor 1 (LEF1) Antibodies
  • LEF1
  • 3000002B05
  • AI451430
  • Lef-1
  • LEF-1
  • TCF10
  • TCF1ALPHA
  • TCF7L3
  • lymphoid enhancer-binding factor 1
  • lymphocyte enhancer binding factor 1
  • lymphoid enhancer binding factor 1
  • lymphoid enhancer factor XLEF-1B
  • LEF1
  • LOC100352691
  • lef1
  • Lef1
Reactivity
Human
119
40
31
9
7
7
5
4
4
4
3
3
2
2
2
1
1
Host
Rabbit
52
47
16
5
Clonality
Polyclonal
Conjugate
This LEF1 antibody is un-conjugated
3
3
3
3
3
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
108
64
20
12
6
4
3
2
2
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4330626
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN793574 ICC WB Mouse IgG1 Log in to see REMB1
1 ABIN793575 ICC IHC WB Mouse IgG1 Log in to see REMB6
1 ABIN221435 ICC FACS IF IP WB Rabbit IgG Pro82 Log in to see
1 ABIN265951 ICC IF WB Mouse IgG1 Log in to see REMB1

Top referenced anti-LEF1 antibody for Immunocytochemistry

  • Human Polyclonal LEF1 Primary Antibody for ICC, IF - ABIN4330626 (1 Publications): Asplund, Gry Björklund, Sundquist, Strömberg, Edlund, Ostman, Nilsson, Pontén, Lundeberg: Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. in The British journal of dermatology 2008 (PubMed)

Similar anti-LEF1 Antibodies

Application / Reactivity Human
Biochemical Assay (BCA) 2 Antibodies
ELISA 64 Antibodies
ELISA (Capture) 1 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 1 Antibodies
Immunocytochemistry (ICC) 5 Antibodies
Immunofluorescence (IF) 21 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 2 Antibodies
Immunohistochemistry (IHC) 13 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies
Immunoprecipitation (IP) 3 Antibodies
RNA Interference (RNAi) 1 Antibodies
Western Blotting (WB) 108 Antibodies

General

Antigen Lymphoid Enhancer-Binding Factor 1 (LEF1) Antibodies
Reactivity Human
(119), (40), (31), (9), (7), (7), (5), (4), (4), (4), (3), (3), (2), (2), (2), (1), (1)
Host Rabbit
(52), (47), (16), (5)
Clonality
Polyclonal
Conjugate This LEF1 antibody is un-conjugated
(3), (3), (3), (3), (3), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(108), (64), (20), (12), (6), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-LEF1 Antibody

Target Details LEF1 Application Details Handling References for anti-LEF1 Antibody (ABIN4330626) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Isotype IgG

Target Details LEF1

Product Details anti-LEF1 Antibody Application Details Handling References for anti-LEF1 Antibody (ABIN4330626) Images back to top
Antigen
Alternative Name LEF1 (LEF1 Antibody Abstract)
Background Gene Symbol: LEF1
Gene ID 51176
Research Area Lineage Markers, Transcription Factors, Wnt
Pathways WNT Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Hormone Metabolic Process, Nuclear Hormone Receptor Binding, Chromatin Binding

Application Details

Product Details anti-LEF1 Antibody Target Details LEF1 Handling References for anti-LEF1 Antibody (ABIN4330626) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-LEF1 Antibody Target Details LEF1 Application Details References for anti-LEF1 Antibody (ABIN4330626) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-LEF1 Antibody (ABIN4330626)

Product Details anti-LEF1 Antibody Target Details LEF1 Application Details Handling Images back to top
Product cited in:

Asplund, Gry Björklund, Sundquist, Strömberg, Edlund, Ostman, Nilsson, Pontén, Lundeberg: "Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma." in: The British journal of dermatology, Vol. 158, Issue 3, pp. 527-38, 2008

Images

Product Details anti-LEF1 Antibody Target Details LEF1 Application Details Handling References for anti-LEF1 Antibody (ABIN4330626) back to top
Supplier Images
Western Blotting (WB) image for anti-LEF1 antibody (Lymphoid Enhancer-Binding Factor 1) (ABIN4330626) Western Blot: LEF1 Antibody [NBP1-86960] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (IF) image for anti-LEF1 antibody (Lymphoid Enhancer-Binding Factor 1) (ABIN4330626) Immunocytochemistry/Immunofluorescence: LEF1 Antibody [NBP1-86960] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-LEF1 antibody (Lymphoid Enhancer-Binding Factor 1) (ABIN4330626) Immunohistochemistry-Paraffin: LEF1 Antibody [NBP1-86960] - Staining of human lymph n...