You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) PKC alpha antibody for Immunohistochemistry (Frozen Sections)

Recommended PKC alpha Antibody (supplied by: Log in to see )

Antigen
Protein Kinase C, alpha (PKCa) Antibodies
  • AAG6
  • AI875142
  • im:7139045
  • LOC100219195
  • pkc-alpha
  • PKC-alpha
  • Pkca
  • PKCA
  • pkcalpha
  • PKRCA
  • PRKACA
  • si:dkey-8l19.1
Epitope
AA 339-597
50
34
17
15
15
13
12
11
7
5
4
4
3
3
3
3
3
3
3
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Mouse (Murine)
253
137
114
23
19
19
16
16
16
3
3
2
1
1
Host
Rabbit
222
42
2
Clonality
Polyclonal
Conjugate
This PKC alpha antibody is un-conjugated
11
10
7
7
5
5
5
5
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
205
122
109
53
49
37
36
22
20
19
15
5
4
2
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN1175207
€ 358.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008829376 ABIN4345802 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345811 ELISA FACS IHC IHC (fro) IHC (p) IP RIA FITC Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345813 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA DyLight 405 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345814 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB DyLight 350 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345815 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB PerCP Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345816 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB Allophycocyanin Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345817 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB DyLight 755 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345818 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB DyLight 680 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345819 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB DyLight 488 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345820 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB DyLight 405LS Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345821 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB Alexa Fluor 405 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345822 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB Alexa Fluor 488 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345823 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB Alexa Fluor 647 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345824 ELISA FACS ICC IF IHC IHC (fro) IHC (p) IP RIA WB Alexa Fluor 700 Mouse IgG2a Log in to see MC5
0.0008829376 ABIN4345803 ELISA IHC IHC (fro) IHC (p) IP WB Rabbit IgG Log in to see G13-R

Similar anti-PKC alpha Antibodies

Application / Reactivity Mouse (Murine)
ELISA 52 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 26 Antibodies
Immunocytochemistry (ICC) 20 Antibodies
Immunofluorescence (IF) 25 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 22 Antibodies
Immunohistochemistry (IHC) 59 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 16 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 39 Antibodies
Immunoprecipitation (IP) 25 Antibodies
Intracellular Staining (ICS) 4 Antibodies
Western Blotting (WB) 100 Antibodies

General

Antigen Protein Kinase C, alpha (PKCa) Antibodies
Epitope AA 339-597
(50), (34), (17), (15), (15), (13), (12), (11), (7), (5), (4), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(253), (137), (114), (23), (19), (19), (16), (16), (16), (3), (3), (2), (1), (1)
Host Rabbit
(222), (42), (2)
Clonality
Polyclonal
Conjugate This PKC alpha antibody is un-conjugated
(11), (10), (7), (7), (5), (5), (5), (5), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(205), (122), (109), (53), (49), (37), (36), (22), (20), (19), (15), (5), (4), (2), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-PKC alpha Antibody

Target Details PKC alpha Application Details Handling Images
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-FN FLMVLGKGSF GKVMLADRKG TEELYAIKIL KKDVVIQDDD VECTMVEKRV LALLDKPPFL TQLHSCFQTV DRLYFVMEYV NGGDLMYHIQ QVGKFKEPQA VFYAAEISIG LFFLHKRGII YRDLKLNNVM LNSEGHIKIA DFGMCKEHMM DGVTTRTFCG TPDYIAPEII AYQPYGKSVD WWAYGVLLYE MLAGQPPFDG EDEDELFQSI MEHNVSYPKS LSKEAVSICK GLMTKQPAKR LGCGPEGERD VREHAFF
Specificity It has been selected for its ability to recognize PKCa in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen Recombinant PKCa expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against PKCa.
Isotype IgG

Target Details PKC alpha

Product Details anti-PKC alpha Antibody Application Details Handling Images back to top
Antigen
Alternative Name Protein Kinase C Alpha (PKCa) (PKCa Antibody Abstract)
Pathways WNT Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-PKC alpha Antibody Target Details PKC alpha Handling Images back to top
Comment

Content: The quality control contains recombinant PKCa (Phe339~Phe597) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions For Research Use only

Handling

Product Details anti-PKC alpha Antibody Target Details PKC alpha Application Details Images back to top
Format Lyophilized
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months

Images

Product Details anti-PKC alpha Antibody Target Details PKC alpha Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PKC alpha antibody (Protein Kinase C, alpha) (AA 339-597) (ABIN1175207) anti-Protein Kinase C, alpha (PKCa) (AA 339-597) antibody