You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rabbit PKC beta antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended PKC beta Antibody (supplied by: Log in to see )

Antigen
Protein Kinase C, beta (PRKCB) Antibodies
  • A130082F03Rik
  • PKC
  • PKC-B
  • PKC-Beta
  • PKC-beta
  • PKCB
  • Pkcb
  • Prkcb
  • Prkcb1
  • PRKCB1
  • prkcb1
  • PRKCB2
  • Prkcb2
  • zgc:63591
Epitope
AA 342-600
44
25
17
12
11
9
8
7
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Reactivity
Rabbit
139
78
74
11
8
6
5
2
1
1
Host
Guinea Pig
156
13
7
6
Clonality
Polyclonal
Conjugate
This PKC beta antibody is un-conjugated
12
9
5
5
5
5
2
Application
Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
155
95
64
24
17
9
6
6
4
3
3
3
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN1860235
$ 398.20
Plus shipping costs $45.00

Similar anti-PKC beta Antibodies

Application / Reactivity Rabbit
ELISA 5 Antibodies
Enzyme Immunoassay (EIA) 1 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunohistochemistry (IHC) 4 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 1 Antibodies
Western Blotting (WB) 9 Antibodies

General

Antigen Protein Kinase C, beta (PRKCB) Antibodies
Epitope AA 342-600
(44), (25), (17), (12), (11), (9), (8), (7), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Rabbit
(139), (78), (74), (11), (8), (6), (5), (2), (1), (1)
Host Guinea Pig
(156), (13), (7), (6)
Clonality
Polyclonal
Conjugate This PKC beta antibody is un-conjugated
(12), (9), (5), (5), (5), (5), (2)
Application Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
(155), (95), (64), (24), (17), (9), (6), (6), (4), (3), (3), (3), (1), (1)
Supplier Log in to see

Product Details anti-PKC beta Antibody

Target Details PKC beta Application Details Handling Images
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGS-FNFLMVLGK GSFGKVMLSE RKGTDELYAV KILKKDVVIQ DDDVECTMVE KRVLALPGKP PFLTQLHSCF QTMDRLYFVM EYVNGGDLMY HIQQVGRFKE PHAVFYAAEI AIGLFFLQSK GIIYRDLKLD NVMLDSEGHI KIADFGMCKE NIWDGVTTKT FCGTPDYIAP EIIAYQPYGK SVDWWAFGVL LYEMLAGQAP FEGEDEDELF QSIMEHNVAY PKSMSKEAVA ICKGLMTKHP GKRLGCGPEG ERDIKDHAFF
Specificity It has been selected for its ability to recognize PKCb1 in immunohistochemical staining and Western blotting.
Purification Affinity Chromatography
Immunogen PKCb1 (AA 342-600)
Isotype IgG

Target Details PKC beta

Product Details anti-PKC beta Antibody Application Details Handling Images back to top
Antigen
Alternative Name Protein Kinase C Beta 1 (PKCb1) (PRKCB Antibody Abstract)
Pathways WNT Signaling

Application Details

Product Details anti-PKC beta Antibody Target Details PKC beta Handling Images back to top
Application Notes Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.
Comment

Content: The quality control contains recombinant PKCb1 (Phe342~Phe600) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions For Research Use only

Handling

Product Details anti-PKC beta Antibody Target Details PKC beta Application Details Images back to top
Format Liquid
Concentration 200 µg/mL
Buffer Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.
Preservative Sodium azide
Precaution of Use WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.
Handling Advice Avoid repeated freeze/thaw cycles
Storage 4 °C
Storage Comment Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.
Expiry Date 12 months

Images

Product Details anti-PKC beta Antibody Target Details PKC beta Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-PKC beta antibody (Protein Kinase C, beta) (AA 342-600) (ABIN1860235) anti-Protein Kinase C, beta (PRKCB) (AA 342-600) antibody