AIF antibody (AA 151-180)

Catalog No. ABIN1099879

This Rabbit Polyclonal antibody specifically detects AIF in WB, IHC and IHC (p). It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for AIF antibody (AA 151-180) (ABIN1099879)

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIF antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-AIF Antibody

Binding Specificity: AA 151-180

Purification: Affinity purified

Immunogen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

Isotype: IgG

Application Details

Application Notes: Approved: IHC, IHC-P (5 μg/mL), WB

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.

Target Details for AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Alternative Name: AIFM1 / AIF / PDCD8

Background: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

Gene ID: 9131

UniProt: O95831

Pathways: Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effect