PTH antibody (AA 1-38)

Catalog No. ABIN110066

Product Details anti-PTH Antibody

Target: PTH (Parathyroid Hormone (PTH))

Binding Specificity: AA 1-38

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: ELISA, Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificity: Human PTH peptide (aa 15-25 1-34 1-38 1-84 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3 1-10 4-16 28-48 39-84 44-68 53-84), PTHrP (aa 1-86)

Purification: Purified

Immunogen: Synthetic human PTH (aa 1-38) poly Lysin conjugated (svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalg)

Clone: A1-64

Application Details

Application Notes: RIA (25 ng/ml) Immunohistochemistry (cryo-sections and paraffin-sections 2 microg/ml) ELISA (1 microg/ml)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone (PTH Products)

Synonyms: PTH1 antibody, Pthp antibody, PTH-(1-84) antibody, Pth1 antibody, Pthr1 antibody, PTH antibody, parathyroid hormone antibody, parathyroid hormone S homeolog antibody, PTH antibody, Pth antibody, pth.S antibody

Target Type: Hormone

Background: Cell culture supernatant, affinity purified, 50 mM TRIS pH 7,4 NaN3 0.05%

Gene ID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process