beta 2 Defensin antibody (AA 4-41)

Catalog No. ABIN191997

There is 1 publication for this product available. The Mouse Monoclonal anti-beta 2 Defensin antibody is suitable to detect beta 2 Defensin in samples from Human. It has been validated for WB, IHC (p) and EIA.

Quick Overview for beta 2 Defensin antibody (AA 4-41) (ABIN191997)

Target: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This beta 2 Defensin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Enzyme Immunoassay (EIA)

Clone: L12-4C-C2

Product Details anti-beta 2 Defensin Antibody

Binding Specificity: AA 4-41

Specificity: This antibody recognizes Human beta-Defensin 2 (aa 4-41).

Characteristics: Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A

Purification: Protein G Chromatography

Immunogen: Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Isotype: IgG1

Application Details

Application Notes: ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Handling

Reconstitution: Restore in 0.1 mL aqua bidest to 1 mg/mL.

Buffer: 50 mM TRIS pH 7.4

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Expiry Date: 12 months

References for anti-beta 2 Defensin antibody (ABIN191997)

Desmet, Van Gele, Grine, Remaut, Lambert: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." in: Experimental dermatology, (2018) (PubMed).

Target Details for beta 2 Defensin

Target: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Alternative Name: Defensin beta 2

Background: This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2

Gene ID: 100289462

UniProt: O15263