Ataxin 1 antibody (AA 164-197) (Atto 594)

Catalog No. ABIN1965661

Product Details anti-Ataxin 1 Antibody (Atto 594)

Target: Ataxin 1 (ATXN1)

Binding Specificity: AA 164-197

Reactivity: Human, Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This Ataxin 1 antibody is conjugated to Atto 594

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Specificity: Detects a 85 kD protein.

Purification: Protein G purified from tissue culture supernatant

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).

Type of Immunogen: Synthetic peptide

Clone: S76-8

Isotype: IgG2b

Application Details

Application Notes: Approved: IHC, IP, WB

Usage: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.4, 0.1 % sodium azide, 50 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: Store at -20°C.

Target Details for Ataxin 1

Target: Ataxin 1 (ATXN1)

Alternative Name: ATXN1 / Ataxin-1 / SCA1 (ATXN1 Products)

Synonyms: ATX1 antibody, D6S504E antibody, SCA1 antibody, ATXN1 antibody, ataxin 1b antibody, atxn1 antibody, 2900016G23Rik antibody, Atx1 antibody, C85907 antibody, ENSMUSG00000074917 antibody, Gm10786 antibody, Sca1 antibody, CG4547 antibody, Dmel\\CG4547 antibody, dAtx-1 antibody, dAtx1 antibody, sca1 antibody, ataxin 1 antibody, ataxin 1b antibody, Ataxin 1 antibody, ATXN1 antibody, atxn1b antibody, Atxn1 antibody, Atx-1 antibody

Background: Name/Gene ID: ATXN1

Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1

Gene ID: 6310

Pathways: Synaptic Membrane