Ataxin 1 antibody (AA 164-197) (Atto 594)
-
- Target See all Ataxin 1 (ATXN1) Antibodies
- Ataxin 1 (ATXN1)
-
Binding Specificity
- AA 164-197
-
Reactivity
- Human, Mouse, Rat
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This Ataxin 1 antibody is conjugated to Atto 594
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
- Specificity
- Detects a 85 kD protein.
- Purification
- Protein G purified from tissue culture supernatant
- Immunogen
-
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).
Type of Immunogen: Synthetic peptide - Clone
- S76-8
- Isotype
- IgG2b
- Top Product
- Discover our top product ATXN1 Primary Antibody
-
-
- Application Notes
-
Approved: IHC, IP, WB
Usage: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested. - Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- PBS, pH 7.4, 0.1 % sodium azide, 50 % glycerol.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C.
-
- Target
- Ataxin 1 (ATXN1)
- Alternative Name
- ATXN1 / Ataxin-1 / SCA1 (ATXN1 Products)
- Synonyms
- ATX1 antibody, D6S504E antibody, SCA1 antibody, ATXN1 antibody, ataxin 1b antibody, atxn1 antibody, 2900016G23Rik antibody, Atx1 antibody, C85907 antibody, ENSMUSG00000074917 antibody, Gm10786 antibody, Sca1 antibody, CG4547 antibody, Dmel\\CG4547 antibody, dAtx-1 antibody, dAtx1 antibody, sca1 antibody, ataxin 1 antibody, ataxin 1b antibody, Ataxin 1 antibody, ATXN1 antibody, atxn1b antibody, Atxn1 antibody, Atx-1 antibody
- Background
-
Name/Gene ID: ATXN1
Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1 - Gene ID
- 6310
- Pathways
- Synaptic Membrane
-