TLR8 antibody (N-Term)

Catalog No. ABIN2153307

This anti-TLR8 antibody is a Goat Polyclonal antibody detecting TLR8 in WB and IHC. Suitable for Human.

Quick Overview for TLR8 antibody (N-Term) (ABIN2153307)

Target: TLR8 (Toll-Like Receptor 8 (TLR8))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TLR8 Antibody

Binding Specificity: AA 81-109, N-Term

Purification: TLR8 antibody was purified by affinity chromatography

Immunogen: TLR8 antibody was raised in Goat using 30 amino acid (aa)synthetic peptide CESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8 as the immunogen

Application Details

Application Notes: IHC: 1:125, WB: 1:500

Restrictions: For Research Use only

Handling

Concentration: Lot specific

Buffer: 10 mM KHPO4, 140 mM NaCl with 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freeze/thaw cycles

Storage: -20 °C

Storage Comment: Aliquot and freeze at -20 °C

Target Details for TLR8

Target: TLR8 (Toll-Like Receptor 8 (TLR8))

Alternative Name: TLR8

Pathways: TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades