RUNX2 antibody (AA 244-278)

Catalog No. ABIN2618054

This Rabbit Polyclonal antibody specifically detects RUNX2 in WB. It exhibits reactivity toward Human, Mouse, Pig, Chimpanzee and Gibbon.

Quick Overview for RUNX2 antibody (AA 244-278) (ABIN2618054)

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Reactivity: Human, Mouse, Pig, Chimpanzee, Gibbon

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RUNX2 Antibody

Binding Specificity: AA 244-278

Specificity: Specifically expressed in osteoblasts.

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Preservative: Sodium azide, Thimerosal (Merthiolate)

Precaution of Use: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Handling Advice: Avoid freeze-thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for RUNX2

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Alternative Name: CBFA1 / RUNX2

Background: Name/Gene ID: RUNX2

Synonyms: RUNX2, AML3, CCD, CCD1, OSF2, PEBP2A1, PEBP2A2, PEA2-alpha A, PEBP2-alpha A, OSF-2, PEBP2A, PEBP2aA1, CBF-alpha-1, CBFA1, Oncogene AML-3, PEA2aA, PEBP2aA

Gene ID: 860