ERBB3 antibody

Catalog No. ABIN2779309

The Rabbit Polyclonal anti-ERBB3 antibody is suitable to detect ERBB3 in samples from Human, Mouse, Rat, Cow, Horse and Guinea Pig. It has been validated for IHC.

Quick Overview for ERBB3 antibody (ABIN2779309)

Target: ERBB3 (Receptor Tyrosine-Protein Kinase ErbB-3 (ERBB3))

Reactivity: Human, Mouse, Rat, Cow, Horse, Guinea Pig

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERBB3 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Product Details anti-ERBB3 Antibody

Purpose: ERBB3 Antibody

Sequence: GLLFSLARGS EVGNSQAVCP GTLNGLSVTG DAENQYQTLY KLYERCEVVM

Predicted Reactivity: Cow: 92%, Guinea Pig: 100%, Horse: 92%, Human: 100%, Mouse: 92%, Rat: 92%

Purification: Affinity Purified

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP30252-100UG

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: prevent freeze-thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Target Details for ERBB3

Target: ERBB3 (Receptor Tyrosine-Protein Kinase ErbB-3 (ERBB3))

Alternative Name: ERBB3

Background:

Background Information: This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.

Gene Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)

Alternative Symbols: HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3

Protein Name: Receptor tyrosine-protein kinase erbB-3

Molecular Weight: 148 kDa

Gene ID: 2065

NCBI Accession: NP_001973

UniProt: P21860

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway