TNF alpha antibody (AA 201-233)

Catalog No. ABIN3029349

This anti-TNF alpha antibody is a Rabbit Polyclonal antibody detecting TNF alpha in WB and IHC (p). Suitable for Human, Mouse and Rat.

Quick Overview for TNF alpha antibody (AA 201-233) (ABIN3029349)

Target: TNF alpha (Tumor Necrosis Factor alpha (TNF alpha))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNF alpha antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-TNF alpha Antibody

Binding Specificity: AA 201-233

Purification: Antigen affinity purified

Immunogen: Amino acids 201-233 (QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL) were used as the immunogen for this TNF alpha antibody.

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting points. Titration of the TNF alpha antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the TNF alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for TNF alpha

Target: TNF alpha (Tumor Necrosis Factor alpha (TNF alpha))

Alternative Name: TNF alpha

Background: Tumor Necrosis Factor alpha is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It binds and functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation and has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.

UniProt: P01375

Pathways: NF-kappaB Signaling, Apoptosis, Caspase Cascade in Apoptosis, TLR Signaling, Cellular Response to Molecule of Bacterial Origin, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Positive Regulation of Endopeptidase Activity, Hepatitis C, Protein targeting to Nucleus, Inflammasome