GJC1 antibody (C-Term)

Catalog No. ABIN3042424

Product Details anti-GJC1 Antibody

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Binding Specificity: AA 333-363, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB in Human,Rat.

Sequence: ADLEALQREI RMAQERLDLA VQAYSHQNNP

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB in Human,Rat.
Gene Name: gap junction protein, gamma 1, 45 kDa
Protein Name: Gap junction gamma-1 protein

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-GJC1 antibody (ABIN3042424)

Zeng, Li, Li, Li, Xiao, Chu, Yang: "Effect of Novel Gasotransmitter hydrogen sulfide on renal fibrosis and connexins expression in diabetic rats." in: Bioengineered, Vol. 7, Issue 5, pp. 314-320, (2017) (PubMed).

Target Details for GJC1

Target: GJC1 (Gap Junction Protein, gamma 1, 45kDa (GJC1))

Alternative Name: GJC1 (GJC1 Products)

Synonyms: CX45 antibody, GJA7 antibody, cx45 antibody, gja7 antibody, MGC52735 antibody, GJD3 antibody, GJC1 antibody, C130009G16Rik antibody, Cnx45 antibody, Cx45 antibody, Gja-7 antibody, Gja7 antibody, gap junction protein gamma 1 antibody, gap junction protein gamma 1 L homeolog antibody, gap junction protein, delta 3, 31.9kDa antibody, gap junction protein, gamma 1 antibody, Gap junction gamma-1 protein antibody, GJC1 antibody, gjc1.L antibody, GJD3 antibody, Gjc1 antibody, gjc1 antibody

Background: Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.

Synonyms: Connexin 45 antibody|Connexin-45 antibody|Connexin45 antibody|CX 31.9 antibody|CX 45 antibody|CX31.9 antibody|Cx45 antibody|CXG1_HUMAN antibody|DKFZp686P0738 antibody|Gap junction alpha 7 protein antibody|Gap junction alpha-7 protein antibody|Gap junction gamma 1 protein antibody|Gap junction gamma-1 protein antibody|Gap junction protein alpha 7 45 kDa antibody|Gap junction protein alpha 7 antibody|Gap junction protein, gamma 1, 45 kDa antibody|GJA 7 antibody|GJA7 antibody|GJC1 antibody|GJD3 antibody

Gene ID: 10052

UniProt: P36383

Pathways: Cell-Cell Junction Organization