PLA2G4A antibody (C-Term)
-
- Target See all PLA2G4A Antibodies
- PLA2G4A (Phospholipase A2, Group IVA (Cytosolic, Calcium-Dependent) (PLA2G4A))
-
Binding Specificity
- AA 682-721, C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLA2G4A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human,Mouse.
- Sequence
- NFQYPNQAFK RLHDLMHFNT LNNIDVIKEA MVESIEYRRQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cytosolic phospholipase A2(PLA2G4A) detection. Tested with WB in Human,Mouse.
Gene Name: phospholipase A2, group IVA (cytosolic, calcium-dependent)
Protein Name: Cytosolic phospholipase A2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PLA2G4A (682-721aa NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ), different from the related mouse and rat sequences by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PLA2G4A Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PLA2G4A (Phospholipase A2, Group IVA (Cytosolic, Calcium-Dependent) (PLA2G4A))
- Alternative Name
- PLA2G4A (PLA2G4A Products)
- Synonyms
- PLA2G4 antibody, cPLA2-alpha antibody, Pla2c antibody, Pla2g4 antibody, cPLA2 antibody, pla2g4 antibody, CPLA2 antibody, PLA2G4A antibody, PLA2 antibody, PLA2G1B antibody, cPLA2alpha antibody, pla2g4a antibody, si:dkey-97o5.1 antibody, phospholipase A2 group IVA antibody, phospholipase A2 group IVA L homeolog antibody, phospholipase A2, group IVA (cytosolic, calcium-dependent) antibody, phospholipase A2, group IVAb (cytosolic, calcium-dependent) antibody, PLA2G4A antibody, Pla2g4a antibody, pla2g4a.L antibody, pla2g4ab antibody
- Background
-
PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).
Synonyms: Calcium dependent phospholipid binding protein antibody|CPLA 2 antibody|cPLA2 alpha antibody|cPLA2 antibody|Cytosolic phospholipase A2 antibody|Cytosolic phospholipase A2 group IVA antibody|Lysophospholipase antibody|MGC126350 antibody|PA24A_HUMAN antibody| Phosphatidylcholine 2 acylhydrolase antibody|Phosphatidylcholine 2-acylhydrolase antibody| Phospholipase A2 group 4 A antibody| Phospholipase A2 group IVA (cytosolic calcium dependent) antibody|Phospholipase A2 group IVA antibody|PhospholipaseA2 antibody|PLA2G4 antibody|pla2g4a antibody - Gene ID
- 5321
- UniProt
- P47712
- Pathways
- Inositol Metabolic Process, G-protein mediated Events, VEGF Signaling
-