MMP3 antibody (C-Term)
-
- Target See all MMP3 Antibodies
- MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))
-
Binding Specificity
- AA 410-439, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Stromelysin-1(MMP3) detection. Tested with WB in Human.
- Sequence
- RFDEKRNSME PGFPKQIAED FPGIDSKIDA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Stromelysin-1(MMP3) detection. Tested with WB in Human.
Gene Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Protein Name: Stromelysin-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product MMP3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Oestrogen and parathyroid hormone alleviate lumbar intervertebral disc degeneration in ovariectomized rats and enhance Wnt/β-catenin pathway activity." in: Scientific reports, Vol. 6, pp. 27521, (2018) (PubMed).
: "Effects of three-dimensional collagen scaffolds on the expression profiles and biological functions of glioma cells." in: International journal of oncology, Vol. 52, Issue 6, pp. 1787-1800, (2018) (PubMed).
: "The Association Between Modic Changes of Lumbar Endplates and Spontaneous Absorption of Herniated Intervertebral Discs." in: Cell biochemistry and biophysics, Vol. 71, Issue 3, pp. 1357-63, (2016) (PubMed).
: "Age dependent changes in cartilage matrix, subchondral bone mass, and estradiol levels in blood serum, in naturally occurring osteoarthritis in Guinea pigs." in: International journal of molecular sciences, Vol. 15, Issue 8, pp. 13578-95, (2015) (PubMed).
: "Antiphotoaging effect of conditioned medium of dedifferentiated adipocytes on skin in vivo and in vitro: a mechanistic study." in: Stem cells and development, Vol. 24, Issue 9, pp. 1096-111, (2015) (PubMed).
: "Intermittent hypobaric hypoxia promotes atherosclerotic plaque instability in ApoE-deficient mice." in: High altitude medicine & biology, Vol. 14, Issue 2, pp. 175-80, (2013) (PubMed).
: "Chitosan-plasmid DNA nanoparticles encoding small hairpin RNA targeting MMP-3 and -13 to inhibit the expression of dedifferentiation related genes in expanded chondrocytes." in: Journal of biomedical materials research. Part A, Vol. 102, Issue 2, pp. 373-80, (2013) (PubMed).
: "Acipimox attenuates atherosclerosis and enhances plaque stability in ApoE-deficient mice fed a palmitate-rich diet." in: Biochemical and biophysical research communications, Vol. 428, Issue 1, pp. 86-92, (2012) (PubMed).
: "Microarray analysis reveals the role of matrix metalloproteinases in mouse experimental autoimmune myocarditis induced by cardiac myosin peptides." in: Cellular & molecular biology letters, Vol. 12, Issue 2, pp. 176-91, (2007) (PubMed).
: "Effects and mechanisms of total glucosides of paeony on joint damage in rat collagen-induced arthritis." in: Inflammation research : official journal of the European Histamine Research Society ... [et al.], Vol. 54, Issue 5, pp. 211-20, (2005) (PubMed).
: "
-
Oestrogen and parathyroid hormone alleviate lumbar intervertebral disc degeneration in ovariectomized rats and enhance Wnt/β-catenin pathway activity." in: Scientific reports, Vol. 6, pp. 27521, (2018) (PubMed).
-
- Target
- MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))
- Alternative Name
- MMP3 (MMP3 Products)
- Synonyms
- CHDS6 antibody, MMP-3 antibody, SL-1 antibody, STMY antibody, STMY1 antibody, STR1 antibody, SLN-1 antibody, SLN1 antibody, STR-1 antibody, Stmy1 antibody, Str1 antibody, MMP10 antibody, chds6 antibody, mmp-3 antibody, mmp13 antibody, mmp3 antibody, sl-1 antibody, stmy antibody, stmy1 antibody, str1 antibody, matrix metallopeptidase 3 antibody, matrix metallopeptidase 3 (stromelysin 1, progelatinase) antibody, matrix metallopeptidase 3 L homeolog antibody, MMP3 antibody, Mmp3 antibody, mmp3.L antibody
- Background
-
Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.
Synonyms: CHDS6 antibody|Matrix metalloproteinase 3 antibody|Matrix metalloproteinase 3 preproprotein antibody|Matrix metalloproteinase-3 antibody|MGC126102 antibody|MGC126103 antibody|MGC126104 antibody|MMP 3 antibody|MMP-3 antibody|MMP3 antibody|MMP3_HUMAN antibody|Progelatinase antibody|Proteoglycanase antibody|SL 1 antibody|SL-1 antibody|SL1 antibody|STMY antibody|STMY1 antibody|STR1 antibody|Stromelisin 1 antibody|Stromelysin 1 antibody|Stromelysin 1 progelatinase antibody|Stromelysin-1 antibody|Transin 1 antibody|Transin-1 antibody - Gene ID
- 4314
- UniProt
- P08254
-