ADRBK2 antibody (C-Term)

Catalog No. ABIN3043729

Product Details anti-ADRBK2 Antibody

Target: ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))

Binding Specificity: AA 635-669, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADRBK2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human.

Sequence: ESDPEFVQWK KELNETFKEA QRLLRRAPKF LNKPR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Beta-adrenergic receptor kinase 2(ADRBK2) detection. Tested with WB in Human.
Gene Name: adrenergic, beta, receptor kinase 2
Protein Name: Beta-adrenergic receptor kinase 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ADRBK2

Target: ADRBK2 (Adrenergic, Beta, Receptor Kinase 2 (ADRBK2))

Alternative Name: ADRBK2 (ADRBK2 Products)

Synonyms: bark2 antibody, grk3 antibody, 4833444A01Rik antibody, AI851927 antibody, AW551196 antibody, Adrbk-2 antibody, Bark-2 antibody, GRK3 antibody, BARK2 antibody, Grk3 antibody, si:dz221d18.1 antibody, G protein-coupled receptor kinase 3 antibody, GRK3 antibody, grk3 antibody, Grk3 antibody

Background: Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85 % amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95 % similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.

Synonyms: ADRBK2 antibody|Adrenergic, beta, receptor kinase 2 antibody|ARBK2_HUMAN antibody|BARK2 antibody|Beta adrenergic receptor kinase 2 antibody|Beta ARK 2 antibody|Beta-adrenergic receptor kinase 2 antibody|Beta-ARK-2 antibody|EC 2.7.11.15 antibody|G protein coupled receptor kinase 3 antibody|G-protein-coupled receptor kinase 3 antibody|GRK3 antibody

Gene ID: 157

UniProt: P35626

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling