AQP2 antibody (C-Term)

Catalog No. ABIN3043788

Product Details anti-AQP2 Antibody

Target: AQP2 (Aquaporin 2 (Collecting Duct) (AQP2))

Binding Specificity: AA 241-271, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AQP2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Aquaporin-2(AQP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EPDTDWEERE VRRRQSVELH SPQSLPRGTK A

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Aquaporin-2(AQP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aquaporin 2 (collecting duct)
Protein Name: Aquaporin-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 2 (241-271aa EPDTDWEEREVRRRQSVELHSPQSLPRGTKA), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-AQP2 antibody (ABIN3043788)

Wang, Bu, Zhang, Chen, Zhang, Bao: "Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 5625-32, (2016) (PubMed).

Cui, Tian, Bai: "Protective effects of propofol on endotoxemia-induced acute kidney injury in rats." in: Clinical and experimental pharmacology & physiology, Vol. 38, Issue 11, pp. 747-54, (2011) (PubMed).

Target Details for AQP2

Target: AQP2 (Aquaporin 2 (Collecting Duct) (AQP2))

Alternative Name: AQP2 (AQP2 Products)

Synonyms: AQP-CD antibody, WCH-CD antibody, cph antibody, jpk antibody, AQP-2 antibody, aquaporin-2 antibody, aquaporin 2 antibody, aquaporin 2 (collecting duct) antibody, Aqp2 antibody, AQP2 antibody

Background: AQP2 (Aquaporin 2), also called AQUAPORIN-CD, is found in the apical cell membranes of the kidney's collecting duct principal cells and in intracellular vesicles located throughout the cell. The AQP2 gene is mapped to chromosome 12q13, very close to the site of major intrinsic protein by situ hybridization. The investigators suggested that a defect in the AQP2 gene is the basis of the autosomal form of nephrogenic diabetes insipidus. The functional expression and the limited localization suggested that AQP2 is the vasopressin-regulated water channel. Using rat kidney slices and porcine kidney cells stably expressing rat Aqp2, AQP2 trafficking can be stimulated by cAMP-independent pathways that utilize nitric oxide (NO). The NO donors sodium nitroprusside (SNP) and NONOate and the NO synthase substrate L-arginine mimicked the effect of vasopressin (VP), stimulating relocation of Aqp2 from cytoplasmic vesicles to the apical plasma membrane. SNP increased intracellular cGMP rather than cAMP, and exogenous cGMP stimulated AQP2 membrane insertion. Atrial natriuretic factor, which signals via cGMP, also stimulated AQP2 translocation. AQP2 expression in kidney connecting tubules is sufficient for survival and that AQP2 expression in collecting ducts is required to regulate body water balance. The S256L substitution in the cytoplasmic tail of the Aqp2 protein prevented phosphorylation at S256 and the subsequent accumulation of Aqp2 on the apical membrane of the collecting duct principal cells.

Synonyms: ADH water channel antibody|AQP 2 antibody|AQP CD antibody|AQP-2 antibody|AQP-CD antibody| AQP2 antibody|AQP2_HUMAN antibody|AQPCD antibody|Aquaporin 2 collecting duct antibody| Aquaporin CD antibody|Aquaporin-2 antibody|Aquaporin-CD antibody|Aquaporin2 antibody| Aquaporine 2 antibody|Collecting duct water channel protein antibody|MGC34501 antibody| Water channel aquaporin 2 antibody|Water channel protein for renal collecting duct antibody|WCH CD antibody|WCH-CD antibody|WCHCD antibody

Gene ID: 359

UniProt: P41181

Pathways: Response to Water Deprivation