Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ATP2A2 antibody (N-Term)

ATP2A2 Reactivity: Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043793
  • Target See all ATP2A2 Antibodies
    ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
    Binding Specificity
    • 8
    • 7
    • 7
    • 6
    • 6
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-32, N-Term
    Reactivity
    • 56
    • 28
    • 28
    • 6
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Mouse, Rat
    Host
    • 54
    • 1
    • 1
    Rabbit
    Clonality
    • 45
    • 11
    Polyclonal
    Conjugate
    • 28
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This ATP2A2 antibody is un-conjugated
    Application
    • 38
    • 23
    • 14
    • 8
    • 6
    • 5
    • 5
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    MENAHTKTVE EVLGHFGVNE STGLSLEQVK KL
    Cross-Reactivity (Details)
    Predicted Cross Reactivity: human
    No cross reactivity with other proteins.
    Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
    Characteristics
    Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
    Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA2 ATPase (1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product ATP2A2 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Guo, Zeng, Zhang, Zhang, Li, Wu, Guan, Liu, Zhang, Li, Wan: "Extracellular matrix of mechanically stretched cardiac fibroblasts improves viability and metabolic activity of ventricular cells." in: International journal of medical sciences, Vol. 10, Issue 13, pp. 1837-45, (2013) (PubMed).

  • Target
    ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
    Alternative Name
    ATP2A2 (ATP2A2 Products)
    Synonyms
    atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, ATP2A2 antibody, ATP2B antibody, DAR antibody, DD antibody, SERCA2 antibody, SERCA2A antibody, ATP2 antibody, Serca2 antibody, SercaII antibody, 9530097L16Rik antibody, D5Wsu150e antibody, SERCA2B antibody, mKIAA4195 antibody, atp2a2 antibody, zgc:55380 antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a antibody, atp2a1.S antibody, ATP2A2 antibody, Atp2a2 antibody, atp2a2a antibody
    Background
    SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

    Synonyms: AT2A2_HUMAN antibody|ATP2A2 antibody|ATP2B antibody|ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody|Calcium pump 2 antibody|Calcium-transporting ATPase sarcoplasmic reticulum type antibody|Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody|Cardiac Ca2+ ATPase antibody|DAR antibody|DD antibody|Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody|MGC45367 antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody|SERCA 2 antibody|SERCA2 antibody|serca2a antibody|slow twitch skeletal muscle isoform antibody|SR Ca(2+)-ATPase 2 antibody
    Gene ID
    488
    UniProt
    P16615
    Pathways
    Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process
You are here:
Support