NPY antibody (Middle Region)

Catalog No. ABIN3043892

Product Details anti-NPY Antibody

Target: NPY (Neuropeptide Y (NPY))

Binding Specificity: AA 29-64, Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPY antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: YPSKPDNPGE DAPAEDMARY YSALRHYINL ITRQRY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Pro-neuropeptide Y(NPY) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: neuropeptide Y
Protein Name: Pro-neuropeptide Y

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Neuropeptide Y is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-NPY antibody (ABIN3043892)

Fan, Mu, Qin, Bi, Pei: "Different effects of implanting sensory nerve or blood vessel on the vascularization, neurotization, and osteogenesis of tissue-engineered bone in vivo." in: BioMed research international, Vol. 2014, pp. 412570, (2015) (PubMed).

Song, Yang, Zhong, Chen: "Sericin protects against diabetes-induced injuries in sciatic nerve and related nerve cells." in: Neural regeneration research, Vol. 8, Issue 6, pp. 506-13, (2014) (PubMed).

Wang, Zhou, Zhang, Wu, Zhang, Zhang: "Identification and localization of gastrointestinal hormones in the skin of the bullfrog Rana catesbeiana during periods of activity and hibernation." in: Acta histochemica, Vol. 116, Issue 8, pp. 1418-26, (2014) (PubMed).

Huang, Zhu, Zhang, Zhu, Liu, Zhu, Wang, Li, Yang, Dong, Liu, Chen, Zhang, Yang, Deng, Fan, Wang, Liu, Ma, Fu, Wu: "S100+ cells: a new neuro-immune cross-talkers in lymph organs." in: Scientific reports, Vol. 3, pp. 1114, (2013) (PubMed).

Wang, Chen, Yue, Bai, Kou, Jin: "Xiaoyaosan decoction regulates changes in neuropeptide y and leptin receptor in the rat arcuate nucleus after chronic immobilization stress." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2012, pp. 381278, (2012) (PubMed).

Target Details for NPY

Target: NPY (Neuropeptide Y (NPY))

Alternative Name: NPY (NPY Products)

Synonyms: 0710005A05Rik antibody, PYY4 antibody, NPY02 antibody, RATNPY antibody, RATNPY02 antibody, si:dkey-22m8.5 antibody, npy antibody, npyb antibody, preproNPY antibody, pyy4 antibody, xnpy antibody, npya antibody, MGC86288 antibody, prepronpy antibody, NPY antibody, NPY1 antibody, neuropeptide Y antibody, neuropeptide Y S homeolog antibody, neuropeptide Y L homeolog antibody, Npy antibody, NPY antibody, npy antibody, npy.S antibody, npy.L antibody, LOC100533423 antibody

Background: This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.

Synonyms: C-flanking peptide of NPY antibody|CPON antibody|Neuropeptide tyrosine antibody|Neuropeptide Y precursor antibody|NPY antibody|NPY_HUMAN antibody|Pro neuropeptide Y antibody|PYY 4 antibody|PYY4 antibody|Y Neuropeptide antibody

Gene ID: 4852

UniProt: P01303

Pathways: Feeding Behaviour