ZBTB7A antibody (N-Term)
-
- Target See all ZBTB7A Antibodies
- ZBTB7A (Zinc Finger and BTB Domain Containing 7A (ZBTB7A))
-
Binding Specificity
- AA 125-163, N-Term
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZBTB7A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Mouse,Rat.
- Sequence
- DLLERQILAA DDVGDASQPD GAGPTDQRNL LRAKEYLEF
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Mouse,Rat.
Gene Name: zinc finger and BTB domain containing 7A
Protein Name: Zinc finger and BTB domain-containing protein 7A - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of mouse ZBTB7A (125-163aa DLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product ZBTB7A Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ZBTB7A (Zinc Finger and BTB Domain Containing 7A (ZBTB7A))
- Alternative Name
- ZBTB7A (ZBTB7A Products)
- Synonyms
- ZBTB7A antibody, FBI-1 antibody, FBI1 antibody, LRF antibody, ZBTB7 antibody, ZNF857A antibody, pokemon antibody, 9030619K07Rik antibody, 9130006G12Rik antibody, AI452336 antibody, Lrf antibody, Pokemon antibody, Zbtb7 antibody, OCZF antibody, zinc finger and BTB domain containing 7A antibody, zinc finger and BTB domain containing 7C antibody, zinc finger and BTB domain containing 7a antibody, ZBTB7A antibody, ZBTB7C antibody, Zbtb7a antibody
- Background
-
Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the ZBTB7A gene. ZBTB7A has a critical oncosuppressive role in the prostate. Prostate-specific inactivation of ZBTB7A leads to a marked acceleration of PTEN loss-driven prostate tumorigenesis through bypass of PTEN loss-induced cellular senescence. It has been showed that ZBTB7A physically interacts with SOX9 and functionally antagonizes its transcriptional activity on key target genes such as MIA, which is involved in tumor cell invasion, and H19, a long noncoding RNA precursor for an RB-targeting microRNA. Inactivation of ZBTB7A in vivo leads to RB downregulation, bypass of PTEN loss-induced cellular senescence, and invasive prostate cancer. Notably, it has been also found that ZBTB7A is genetically lost, as well as downregulated at both the mRNA and protein levels, in a subset of human advanced prostate cancers. Therefore, ZBTB7A is identified as a context-dependent cancer gene that can act as an oncogene in some contexts but that also has oncosuppressive-like activity in PTEN-null tumors.
Synonyms: DKFZp547O146 antibody|Factor binding IST protein 1 antibody|Factor that binds to inducer of short transcripts protein 1 antibody|FBI-1 antibody|FBI1 antibody|HIV-1 1st-binding protein 1 antibody|HIV-1 inducer of short transcripts binding protein antibody|HIV-1 inducer of short transcripts-binding factor 1 antibody|Leukemia/lymphoma-related factor antibody|LRF antibody|lymphoma related factor antibody|MGC99631 antibody|POK erythroid myeloid ontogenic factor antibody|Pokemon antibody|POZ and Krueppel erythroid myeloid ontogenic factor antibody|TIP21 antibody|TTF-I-interacting peptide 21 antibody|ZBT7A_HUMAN antibody|ZBTB7 antibody|ZBTB7A antibody| Zinc finger and BTB domain containing 7A antibody|zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein antibody|Zinc finger and BTB domain-containing protein 7A antibody|Zinc finger protein 857A antibody|Zinc finger- and BTB domain-containing protein 7 antibody|ZNF857A antibody - Gene ID
- 16969
- UniProt
- O88939
-