TLR8 antibody (AA 81-109)
-
- Target See all TLR8 Antibodies
- TLR8 (Toll-Like Receptor 8 (TLR8))
-
Binding Specificity
- AA 81-109
-
Reactivity
- Human
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This TLR8 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunocytochemistry (ICC)
- Specificity
- Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.
- Predicted Reactivity
- Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%) Monkey (93%) Marmoset (86%).
- Purification
- Immunoaffinity purified
- Immunogen
-
30 amino acid (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%), Monkey (93%), Marmoset (86%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product TLR8 Primary Antibody
-
-
- Application Notes
- Approved: ICC (1:200), WB
- Comment
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Aliquot to Avoid freeze/thaw cycles.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Target
- TLR8 (Toll-Like Receptor 8 (TLR8))
- Alternative Name
- TLR8 (TLR8 Products)
- Synonyms
- CD288 antibody, toll like receptor 8 antibody, toll-like receptor 8 antibody, TLR8 antibody, Tlr8 antibody
- Background
-
Name/Gene ID: TLR8
Family: Toll-like Receptor
Synonyms: TLR8, CD288, Toll-like receptor 8, CD288 antigen - Gene ID
- 51311
- UniProt
- Q9NR97
- Pathways
- TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades
-