TLR8 antibody (AA 81-109)

Catalog No. ABIN342784

Product Details anti-TLR8 Antibody

Target: TLR8 (Toll-Like Receptor 8 (TLR8))

Binding Specificity: AA 81-109

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This TLR8 antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC)

Specificity: Peptide sequence is <50 % identical to other human TLR receptors in this region. The antibody recognizes human TLR8 and mouse TLR8.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%) Monkey (93%) Marmoset (86%).

Purification: Immunoaffinity purified

Immunogen: 30 amino acid (aa)synthetic peptide C-ESFQGLQNLTKINLNHNPNVQHQNGNPGI corresponding to aa 81-109 of the N-terminal domain of Human TLR8. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%), Monkey (93%), Marmoset (86%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ICC (1:200), WB

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Phosphate buffered saline, 1 mg/mL BSA, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Aliquot to Avoid freeze/thaw cycles.

Storage: -20 °C

Storage Comment: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Target Details for TLR8

Target: TLR8 (Toll-Like Receptor 8 (TLR8))

Alternative Name: TLR8 (TLR8 Products)

Synonyms: CD288 antibody, toll like receptor 8 antibody, toll-like receptor 8 antibody, TLR8 antibody, Tlr8 antibody

Background: Name/Gene ID: TLR8
Family: Toll-like Receptor

Synonyms: TLR8, CD288, Toll-like receptor 8, CD288 antigen

Gene ID: 51311

UniProt: Q9NR97

Pathways: TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades