GADD45A antibody (C-Term)
-
- Target See all GADD45A Antibodies
- GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))
-
Binding Specificity
- AA 125-165, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GADD45A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha(GADD45A) detection. Tested with WB in Human.
- Sequence
- VLVTNPHSSQ WKDPALSQLI CFCRESRYMD QWVPVINLP
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha(GADD45A) detection. Tested with WB in Human.
Gene Name: growth arrest and DNA-damage-inducible, alpha
Protein Name: Growth arrest and DNA damage-inducible protein GADD45 alpha - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human GADD45A (125-165aa VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLP ER), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product GADD45A Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GADD45A (Growth Arrest and DNA-Damage-Inducible, alpha (GADD45A))
- Alternative Name
- GADD45A (GADD45A Products)
- Synonyms
- MGC53491 antibody, zgc:91795 antibody, gadd45a antibody, GADD45A antibody, ddit1 antibody, gadd45 antibody, GADD45 antibody, AA545191 antibody, Ddit1 antibody, DDIT1 antibody, Gadd45 antibody, growth arrest and DNA damage inducible alpha L homeolog antibody, growth arrest and DNA-damage-inducible, alpha, b antibody, growth arrest and DNA damage inducible alpha antibody, growth arrest and DNA damage-inducible protein 45 antibody, growth arrest and DNA-damage-inducible 45 alpha antibody, growth arrest and DNA-damage-inducible, alpha antibody, gadd45a.L antibody, gadd45ab antibody, GADD45A antibody, gadd45a antibody, GADD45 antibody, Gadd45a antibody
- Background
-
Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.
Synonyms: DDIT1 | DDIT-1 | DDIT1 | GADD45 | GA45A | GADD45A | P24522 - Gene ID
- 1647
- UniProt
- P24522
- Pathways
- p53 Signaling, Cell Division Cycle
-