Aquaporin 1 antibody

Catalog No. ABIN4950191

Product Details anti-Aquaporin 1 Antibody

Target: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aquaporin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Aquaporin 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Aquaporin 1

Target: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Alternative Name: AQP1 / Aquaporin 1 (AQP1 Products)

Synonyms: fj33g04 antibody, zgc:85890 antibody, wu:fj33g04 antibody, AQP1 antibody, CHIP28 antibody, AQP-CHIP antibody, CO antibody, AQP-1 antibody, CHIP29 antibody, aquaporin 1a (Colton blood group), tandem duplicate 1 antibody, aquaporin 1 antibody, aquaporin 1 (Colton blood group) antibody, aqp1a.1 antibody, AQP1 antibody, Aqp1 antibody

Background: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

UniProt: P29972

Pathways: Hormone Transport