FMO2 antibody

Catalog No. ABIN4951058

Product Details anti-FMO2 Antibody

Target: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMO2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FMO2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FMO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FMO2

Target: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Alternative Name: FMO2 (FMO2 Products)

Synonyms: FMO 1B1 antibody, FMO 2 antibody, FMO1B1 antibody, 2310008D08Rik antibody, 2310042I22Rik antibody, AW107733 antibody, MGC68715 antibody, FMO4 antibody, FMO2 antibody, flavin containing monooxygenase 2 antibody, flavin containing monooxygenase 2 L homeolog antibody, FMO2 antibody, Fmo2 antibody, fmo2.L antibody

Background: Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2). It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.

UniProt: Q99518