HPSE antibody

Catalog No. ABIN4951290

Product Details anti-HPSE Antibody

Target: HPSE (Heparanase (HPSE))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HPSE antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for HPSE

Target: HPSE (Heparanase (HPSE))

Alternative Name: Heparanase 1 (HPSE Products)

Synonyms: im:7144134 antibody, hpa antibody, hpa1 antibody, hpr1 antibody, hpse1 antibody, hse1 antibody, HPSE antibody, HPA antibody, HPA1 antibody, HPR1 antibody, HPSE1 antibody, HSE1 antibody, Hpa antibody, Hpr1 antibody, Hep antibody, heparanase antibody, HPSE antibody, hpse antibody, Hpse antibody

Background: Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

UniProt: Q9Y251

Pathways: Glycosaminoglycan Metabolic Process