IKZF1 antibody

Catalog No. ABIN4951433

Product Details anti-IKZF1 Antibody

Target: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IKZF1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids LKEEHRAYDLLRAASENSQDALRVVSTSGEQM of human IKZF1 were used as the immunogen for the IKAROS antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IKAROS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IKAROS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IKZF1

Target: IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))

Alternative Name: IKAROS / IKZF1 (IKZF1 Products)

Synonyms: Hs.54452 antibody, IK1 antibody, IKAROS antibody, LYF1 antibody, PRO0758 antibody, ZNFN1A1 antibody, hIk-1 antibody, RGD1562979 antibody, ikaros antibody, znfn1a1 antibody, ik1 antibody, lyf1 antibody, hik-1 antibody, pro0758 antibody, hs.54452 antibody, MGC108252 antibody, 5832432G11Rik antibody, Ikaros antibody, LyF-1 antibody, Zfpn1a1 antibody, Znfn1a1 antibody, hlk-1 antibody, mKIAA4227 antibody, ikzf1 antibody, IKAROS family zinc finger 1 antibody, IKAROS family zinc finger 1 (Ikaros) antibody, IKZF1 antibody, Ikzf1 antibody, ikzf1 antibody

Background: DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

UniProt: Q13422

Pathways: Production of Molecular Mediator of Immune Response