-
- Target See all ING1 Antibodies
- ING1 (Inhibitor of Growth Family, Member 1 (ING1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ING1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids KELDECYERFSRETDGAQKRRMLHCVQRALIR of human Inhibitor of growth protein 1 were used as the immunogen for the ING1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ING1 Primary Antibody
-
anti-Inhibitor of Growth Family, Member 1 (ING1) (N-Term) antibody
ING1 Reactivity: Human WB, ELISA, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (N-Term) antibody (FITC)ING1 Reactivity: Human WB, ELISA, IF, ICC Host: Rabbit Polyclonal FITC
anti-Inhibitor of Growth Family, Member 1 (ING1) (N-Term) antibody (Atto 594)ING1 Reactivity: Human WB, ELISA, IF, ICC Host: Rabbit Polyclonal Atto 594
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 260-353) antibodyING1 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 285-296) antibodyING1 Reactivity: Human WB, ELISA Host: Goat Polyclonal unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 1-279) antibodyING1 Reactivity: Human WB, IP Host: Rabbit Polyclonal unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 41-140) antibodyING1 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 1C9 unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 1-279) antibodyING1 Reactivity: Human WB, IF Host: Mouse Polyclonal unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 41-140) antibodyING1 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 2E5 unconjugated
anti-Inhibitor of Growth Family, Member 1 (ING1) (AA 301-422) antibodyING1 Reactivity: Human, Mouse WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal dilution of the ING1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the ING1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ING1 (Inhibitor of Growth Family, Member 1 (ING1))
- Alternative Name
- ING1 (ING1 Products)
- Synonyms
- p24ING1c antibody, p33 antibody, p33ING1 antibody, p33ING1b antibody, p47 antibody, p47ING1a antibody, p33ING1c antibody, zgc:136918 antibody, ING1 antibody, 2610028J21Rik antibody, AA407184 antibody, AI875420 antibody, mING1h antibody, p33Ing1 antibody, p37Ing1b antibody, xing1 antibody, inhibitor of growth family member 1 antibody, inhibitor of growth family, member 1 antibody, inhibitor of growth family member 1 S homeolog antibody, ING1 antibody, Ing1 antibody, ing1 antibody, ing1.S antibody
- Background
- Inhibitor of growth protein 1 is a protein that in humans is encoded by the ING1 gene. It is mapped to 13q34. This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
- UniProt
- Q9UK53
- Pathways
- Protein targeting to Nucleus, Autophagy
-
You are here:
