KCNA3 antibody

Catalog No. ABIN4951520

Product Details anti-KCNA3 Antibody

Target: KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ of human KCNA3 were used as the immunogen for the KCNA3 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the KCNA3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the KCNA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for KCNA3

Target: KCNA3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 3 (KCNA3))

Alternative Name: KCNA3 / Kv1.3 (KCNA3 Products)

Synonyms: Kv1.3-glyb antibody, kv1.3 antibody, Kv1.3B antibody, kcna3b-a antibody, HGK5 antibody, HLK3 antibody, HPCN3 antibody, HUKIII antibody, KV1.3 antibody, MK3 antibody, PCN3 antibody, Kca1-3 antibody, Kv1.3 antibody, Mk-3 antibody, cKv1.1 antibody, potassium voltage-gated channel subfamily A member 3 antibody, potassium channel, voltage gated shaker related subfamily A, member 3 S homeolog antibody, potassium voltage-gated channel, shaker-related subfamily, member 3 antibody, KCNA3 antibody, kcna3.S antibody, Kcna3 antibody

Background: Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.

UniProt: P22001