LIM Domain Kinase 1 antibody

Catalog No. ABIN4951616

Product Details anti-LIM Domain Kinase 1 Antibody

Target: LIM Domain Kinase 1 (LIMK1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIM Domain Kinase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR of human LIMK1 were used as the immunogen for the LIMK antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LIMK antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LIMK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LIM Domain Kinase 1

Target: LIM Domain Kinase 1 (LIMK1)

Alternative Name: LIM Kinase 1 / LIMK1 (LIMK1 Products)

Synonyms: limk1 antibody, xlimk1 antibody, GB16654 antibody, LIMK1 antibody, LIMK antibody, LIMK-1 antibody, LIM domain kinase 1 antibody, LIM domain kinase 1a antibody, LIM domain kinase 1 L homeolog antibody, LIM-domain containing, protein kinase antibody, LIMK1 antibody, limk1a antibody, limk1 antibody, CpipJ_CPIJ000717 antibody, LOC413152 antibody, Limk1 antibody, limk1.L antibody

Background: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.

UniProt: P53667

Pathways: Caspase Cascade in Apoptosis, Regulation of Cell Size, CXCR4-mediated Signaling Events